cpnDB: A Chaperonin Database
October 21, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19685 - LAST ADDITION: 2014-09-21

RECORD DETAILS

For gi 123197646, see also: b12863

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b12862
Chaperonin Group: I
Deposit Date: 2009-01-18
Type: ref
Type strain?: no
Genus: Prochlorococcus
Species: marinus
Strain: AS9601
Lineage: root; cellular organisms; Bacteria; Cyanobacteria; Prochlorales; Prochlorococcaceae; Prochlorococcus
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: CP000551
Nucleotide Genbank gi: 123197646
Peptide Genbank Accession: ABM69795
Peptide Genbank gi: 123198154
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: -
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCTAAACAGTTAAATTTTTCTAATGAATCAAGAGAAGCGCTAGAAAAAGGTGTGAAT
TTTGTAGCTAATGCAGTAAAGGTTACTATTGGGCCAAAAGCAAAAAACGTTGTAATAGAA
AAGAAATTTGGTTCGCCGGATATAGTAAGAGATGGATCTACAGTTGCTAAAGAGATCGAG
ATTGAAAACCCTATTGCTAATTTAGGTGCGAAATTAATAGAACAAGTCGCATCCAAGACA
AAAGAGAGTGCTGGTGATGGGACAACAACAGCAACCATTTTGACTCAGAAGATGGTTCAG
GAGGGATTAAAAAATATTGCTTCTGGTGCCAACCCTATGGAGTTAAAAAAAGGTATGGAA
GCAGGCCTAGCTTTTGTCTTAGAAAAATTAAGTTCCAAAAGTATTTCATTAAGTGGTTCT
GACATCCAAAAAGTTGCAACAGTTAGTGCTGGAGGTGATGAAGAAATTGGATCTATAATT
TCGAAAGCAATGGATATTGTTACTTCAGATGGTGTAATAACTGTTGAAGAATCTCAATCA
TTAGAAACAGAATTAGATATAACTGAAGGAATGTCTTTTGATAGAGGTTATAGTTCTCCA
TATTTCGTAACAGACCAAGAAAGACAAGTTTGTGAACTTGAAAACCCTAAAATATTAATA
ACTGATCAAAAAATCTCAACTTTAGTTGATCTAGTTCCAATACTTGAAGAAATTCAAAAG
GCGGGCTCACCTTTTCTAATTCTTGCTGAAGATATTGAAGGAGAGGCTTTAACTACTCTG
GTTTTGAATAAGAATAGTGGGGTTTTAAATGTAGCTTCCGTGAGAGCTCCTTTATTTGGT
GAGAGAAGAAAAGCTGCCCTTGAAGATATTGCAATTCTTACAGGGGCTAAGTTAATTAGC
GAAGATAAATCGATGACACTTGATAAAGTATCTATTAATGATTTAGGCAAAGCAAAAAAA
ATAACTATCACAAAGGATAAAACTACAATTGTTGCCTTCGAAGACACTAAAGATTTAGTT
GAAGCGCGAGTAGAGAAATTAAAGAGAGAAGTTAACATAACTGAATCTGAGTATGATCAG
GACAAAATCAATGAAAGGATAGCCAAACTAGCCGGAGGAGTAGCTCTTATCAAAGTAGGA
GCTGCTACAGAAACAGAGATGAAATATAAAAAGTTGAGAATTGAAGATTCCCTTAATGCT
ACGAAAGCTGCTATTGAAGAGGGTGTTGTTTCTGGAGGAGGACAAACTTTAATTGAAATA
TCAGATGACCTTTTAAATTTAAGTGAAACATCTTCAGATGATTTAAGAACAGGGATAAAT
ATAGTTAAAGAAGCCCTTTTGGAACCTACCAAACAAATAGCAAAAAATGCTGGTTTTAAT
GGTGATGTAGTTGTCGCTGAAATTCAAAGGCTTAACAAAGGCTTTAATGCTAATTCAGGA
CAATATGAGGATTTAAAAGATTCAGGAATATTAGATCCAACCAAAGTAATAAGATTAGCT
CTTCAAGATTCAGTATCTATTGCAGCTATGCTCCTCACAACAGAAGTTGCGATGGCAGAC
ATTCCAGAGCCTGAAGCCGCGGCCCCTGGAGGACCAGGTGGAGATCCAATGGGAGGAATG
GGTGGCATGGGAATGCCAGGAATGGGTGGCATGGGAATGCCGGGTATGGGTGGCATGGGA
ATGCCGGGTATGGGTGGCATGGGAATGCCAGGAATGGGTGGCATGGGAATGCCGGGTATG
ATGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAKQLNFSNESREALEKGVNFVANAVKVTIGPKAKNVVIEKKFGSPDIVRDGSTVAKEIE
IENPIANLGAKLIEQVASKTKESAGDGTTTATILTQKMVQEGLKNIASGANPMELKKGME
AGLAFVLEKLSSKSISLSGSDIQKVATVSAGGDEEIGSIISKAMDIVTSDGVITVEESQS
LETELDITEGMSFDRGYSSPYFVTDQERQVCELENPKILITDQKISTLVDLVPILEEIQK
AGSPFLILAEDIEGEALTTLVLNKNSGVLNVASVRAPLFGERRKAALEDIAILTGAKLIS
EDKSMTLDKVSINDLGKAKKITITKDKTTIVAFEDTKDLVEARVEKLKREVNITESEYDQ
DKINERIAKLAGGVALIKVGAATETEMKYKKLRIEDSLNATKAAIEEGVVSGGGQTLIEI
SDDLLNLSETSSDDLRTGINIVKEALLEPTKQIAKNAGFNGDVVVAEIQRLNKGFNANSG
QYEDLKDSGILDPTKVIRLALQDSVSIAAMLLTTEVAMADIPEPEAAAPGGPGGDPMGGM
GGMGMPGMGGMGMPGMGGMGMPGMGGMGMPGMGGMGMPGMM
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCAACCATTTTGACTCAGAAGATGGTTCAGGAGGGATTAAAAAATATTGCTTCTGGTGCC
AACCCTATGGAGTTAAAAAAAGGTATGGAAGCAGGCCTAGCTTTTGTCTTAGAAAAATTA
AGTTCCAAAAGTATTTCATTAAGTGGTTCTGACATCCAAAAAGTTGCAACAGTTAGTGCT
GGAGGTGATGAAGAAATTGGATCTATAATTTCGAAAGCAATGGATATTGTTACTTCAGAT
GGTGTAATAACTGTTGAAGAATCTCAATCATTAGAAACAGAATTAGATATAACTGAAGGA
ATGTCTTTTGATAGAGGTTATAGTTCTCCATATTTCGTAACAGACCAAGAAAGACAAGTT
TGTGAACTTGAAAACCCTAAAATATTAATAACTGATCAAAAAATCTCAACTTTAGTTGAT
CTAGTTCCAATACTTGAAGAAATTCAAAAGGCGGGCTCACCTTTTCTAATTCTTGCTGAA
GATATTGAAGGAGAGGCTTTAACTACTCTGGTTTTGAATAAGAATAGTGGGGTTTTAAAT
GTAGCTTCCGTG
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATILTQKMVQEGLKNIASGANPMELKKGMEAGLAFVLEKLSSKSISLSGSDIQKVATVSA
GGDEEIGSIISKAMDIVTSDGVITVEESQSLETELDITEGMSFDRGYSSPYFVTDQERQV
CELENPKILITDQKISTLVDLVPILEEIQKAGSPFLILAEDIEGEALTTLVLNKNSGVLN
VASV
Comments or questions...