cpnDB: A Chaperonin Database
October 21, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19685 - LAST ADDITION: 2014-09-21

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b10458
Chaperonin Group: II
Deposit Date: 2007-10-01
Type: ref
Type strain?: no
Genus: Giardia
Species: lamblia
Strain: WB C6
Lineage: root; cellular organisms; Eukaryota; Fornicata; Diplomonadida; Hexamitidae; Giardiinae; Giardia
Original ID: ATCC 50803
CUTC ID: -
Nucleotide Genbank Accession: AACB02000021
Nucleotide Genbank gi: 157434665
Peptide Genbank Accession: EDO78951
Peptide Genbank gi: 157434723
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: From whole genome shotgun sequence. Alpha subunit.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGACCAGCAACGCCATCTTCTTGCCAGGTGAACTCAACTCAGGAAACAGTGTGCGTAAG
GAGAATATTTCTGCAACCACTGCATTAGCAGGGATCATCCGGACGACCTTAGGCCCAACC
GGGATGGACAAAATGTTGATAGATAGCATGGGCGAAGTCACAGTCACCAACGATGGTGCG
ACCATTCTGCAAAAGCTCAACGTTGCCCATCCTGCGGCAAAGATCCTGGTGGAGCTTTCT
TCCCTTCAGGATAGGGAAGTTGGTGATGGCACCACCAGTGTGGTCATCTTTGCATCGGAA
TTCCTTAAGGAGGCAGACGAGCTTATCGGCCGTAACATGCACCCCACAATTGTGATTGAG
GGCTATCAACTGGCCCTAAAGAAAGCATTGAACTATATAGAGAAACGCCTCAAGGTCAAC
GCCTCTGCATTGACACGCGAGAATTTTCTGAACGTTGCCCTCACATCACTGTCTTCGAAG
ATTGTCAGTCTAACCGCAGAGCACTTCGCCAACATCGTCGTTGACGCTGTTTTTGCCGTC
AAGCACATCACAGAGGCAGGCGTCACTAAATATCCAATAAAGTCTATTGGAATTCTGAAG
GCTCATGGAGGCGCTGCGCGAGAGTCTTATCTTGTCAAGGGCTTTGCTCTGCACCAATCC
AGGGCTTCCTTGCAGATGCCGAGTTCTGTCAGGGCGGCGAAGATAGCTCTTTTGGACTTC
AATCTTCAGCAGCAACGCCTTGCTGTGGGGACTCAGATTCTTATCACCGATGCATCAAAG
ATGGAGGGCGTGCGCCAAATGGAAAACGACATAGTTAAGAAGCGCATTGAGGTGCTCCTG
GCAGCAGGGGCAACGGTTGTCTTCACCACAGGAGGAATTGATGATATGGCGCAAAAATAC
CTTGTGGAGCAGGGCATAATGGGCGTACGACGTATACCAGCAGACGACATGAAGCGCATA
GCGAAGGTGACTGGTGGAGAGATACTGGGGACTCTTGCAGACCTCGACGGGGAGGAGACT
CTACCTCCTTCTTGCCTTGGGTTTGCCGAGGAAGTAATAGAGGAACGCATTGCTGATGAT
AATATCATCTTCATACGAGGCGGGAAAGGAAGAGCGACAGGTTCCATTATTCTCCGCGGG
CCAAATATCCACATGGTGGAAGAGATGGAGAGGTCCATACACGACGCTCTGTGTGCTGTC
TCGAAGACCCTGGAGTCGGATGCCGTGGTCGCAGGTGGAGGGTGCATTGAAACCGCGCTG
AGTGCTTATCTGGAGGAGGTCGCACGGTCTATCGATAATAAAACACAGCTTGCTGTGATG
GCCTTCTCTCGTGCCCTTTTAGCCATTCCGCGGCAACTGGCGGTGAATTCTGCCCTGGAT
GCAACCAAACTTATTGCAGAGCTGCGCGCAGTTCATGCCAGAGCCATACTCAAAGAAACT
CCTGCTGAGGAGAAAGAAAAACTTAGGCATTATGGTCTGGATCTTCAGAACGGCGTCATA
TGTGACAACGTCCAGGCAGGAGTTCTGGAGCCTATGTCTAACAAACTTAAGAGTCTTTCC
TTTGCGGTGGAAGCTGCTGTGACGATTCTCAGGATAGATGACAGCATAAGATTGAATCCA
GAGCAGCAGCAATCCGTCCAGGATCACCATTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MTSNAIFLPGELNSGNSVRKENISATTALAGIIRTTLGPTGMDKMLIDSMGEVTVTNDGA
TILQKLNVAHPAAKILVELSSLQDREVGDGTTSVVIFASEFLKEADELIGRNMHPTIVIE
GYQLALKKALNYIEKRLKVNASALTRENFLNVALTSLSSKIVSLTAEHFANIVVDAVFAV
KHITEAGVTKYPIKSIGILKAHGGAARESYLVKGFALHQSRASLQMPSSVRAAKIALLDF
NLQQQRLAVGTQILITDASKMEGVRQMENDIVKKRIEVLLAAGATVVFTTGGIDDMAQKY
LVEQGIMGVRRIPADDMKRIAKVTGGEILGTLADLDGEETLPPSCLGFAEEVIEERIADD
NIIFIRGGKGRATGSIILRGPNIHMVEEMERSIHDALCAVSKTLESDAVVAGGGCIETAL
SAYLEEVARSIDNKTQLAVMAFSRALLAIPRQLAVNSALDATKLIAELRAVHARAILKET
PAEEKEKLRHYGLDLQNGVICDNVQAGVLEPMSNKLKSLSFAVEAAVTILRIDDSIRLNP
EQQQSVQDHH
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...