cpnDB: A Chaperonin Database
July 24, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19655 - LAST ADDITION: 2014-06-29

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b6993
Chaperonin Group: II
Deposit Date: 2004-11-01
Type: ref
Type strain?: no
Genus: Giardia
Species: lamblia
Strain: WB C6
Lineage: root; cellular organisms; Eukaryota; Fornicata; Diplomonadida; Hexamitidae; Giardiinae; Giardia
Original ID: ATCC 50803
CUTC ID: -
Nucleotide Genbank Accession: AACB02000015
Nucleotide Genbank gi: 157435327
Peptide Genbank Accession: EDO79587
Peptide Genbank gi: 157435365
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Synonym Giardia intestinalis ATCC50803. Delta subunit. From whole genome shotgun sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCTCAGCTTGTCAGGGATGAGGGCAATGAGAAGCAGGCAGACGTTCGCGTATCCAAT
ATCCAGGCAGCCAAGGGAATCTTTGACCTCATACGCACCTCATTAGGGCCTCGTGGTCTC
GATAAGATGGTCACAACACCGAAGGGAGACGTCCTTATCACGAATGACGGTGCGACAATT
ATGAAGCAGTTGGAGGCTCGTCACCCGGCTGCACGCATGCTCATAGAGCTTTCTCAGAGC
CAAGACATCGAAGCGGGAGATGGCACGACAACTGTGGTCGTTCTCGCTGGGAGGCTGCTT
GCTAACTGTCTAGACCTTTTCAAGCTTGGAATCCATCCGACAGCAATATCGGAGGCCTAC
CAGGTGGCCTGTGACGAGGCTGTGAAGGTTGTCATGTCCATTGCCCGCCCCGTTGATCTC
AAGAACCGTGAGGAGCTGATCAACATTTGCAAAACAACACTATCAAGCAAGATCATTTCT
CACCATTCTGACCACCTTGCACCCTTAATCCTCGACTCTGTGCTTCGCGTGTCAGATTCG
GACAACGTTGACTTGAGTCGTATACACGTAATCAAACGATTAGGAGGGACCGTGGACGAA
AGCAGATTAACCACTGGTCTTGCATTTGCAAGGCGTCCCACAGAGGGGCCCGGGTTCTGT
GAAAAGGTGAAGATAGGTATCGCAAGGTTCTGCCTGTCCCCGCCCAAGACAGACATGGAG
GCTAATCTTATTGTTCATGACTCCGACGCAATAGATCGCCTTTTAGAGCAGGAGCGTAAG
CTGACTGCTAAGATGTGCAAGAAGATCGCAAGCTCTGGGTGCAACGTGCTTCTTCTGCAG
AAGTCCATTATGCGTGAGGCCGTCAGTGACATGGCGCTTCACTTTCTGAAGAAGCTGAAG
ATCACCGTCATCGATGACATAGAACGCGAAGAAATAGACTTCATAGCCACCACTACCGGA
GCTACGCCAGTCGCTACGATAGATGAGTTTACCTCGGATAAACTGGGCTCAATGGGTGAG
CTGACTGTCGTAGATGGAGTTACATATATCTCCAGGAATCAAGACGAGGAAAAGAGTGTC
AAGACATGTACCATCATAGTGAGAGGCGCAAACAAACTGATCCTCGATGAGGCCGTGCGC
TCCGTGCACGATGGCCTCTGTGCAATCCGCTGTCTCATTAAGAAAGGATTTATAATCCCT
GGTGGTGCCGCTGTCGAGACCGAGATCGCTAGGTGCTTATATGAGCGCAGCCACTCCCAG
ACAGGCGTGGGTCAGTACTGTATGCGTGCCTTTGCAGATGCATTCGAAATAATTCCCCTT
ACACTGGCTGAAAACGCCGGACTCTCCCCAATCACAACCCTTACGGAACTGAGGCGCGTC
CATAAGAAAGGCGGAACGACCTACGGATTAGATATTAATAGGGGCGGAGAGATCTCAGAG
ATGTTCGCTCTAAATGTAATACAGCCTGCTCTAGTGACTATCAGCGCCATAACTCTTGCG
ACAGAGACGACGCGTATGCTCTTGAAGATTGACGATATTGTTCTAGGCAGATGA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAQLVRDEGNEKQADVRVSNIQAAKGIFDLIRTSLGPRGLDKMVTTPKGDVLITNDGATI
MKQLEARHPAARMLIELSQSQDIEAGDGTTTVVVLAGRLLANCLDLFKLGIHPTAISEAY
QVACDEAVKVVMSIARPVDLKNREELINICKTTLSSKIISHHSDHLAPLILDSVLRVSDS
DNVDLSRIHVIKRLGGTVDESRLTTGLAFARRPTEGPGFCEKVKIGIARFCLSPPKTDME
ANLIVHDSDAIDRLLEQERKLTAKMCKKIASSGCNVLLLQKSIMREAVSDMALHFLKKLK
ITVIDDIEREEIDFIATTTGATPVATIDEFTSDKLGSMGELTVVDGVTYISRNQDEEKSV
KTCTIIVRGANKLILDEAVRSVHDGLCAIRCLIKKGFIIPGGAAVETEIARCLYERSHSQ
TGVGQYCMRAFADAFEIIPLTLAENAGLSPITTLTELRRVHKKGGTTYGLDINRGGEISE
MFALNVIQPALVTISAITLATETTRMLLKIDDIVLGR
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...