cpnDB: A Chaperonin Database
November 26, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19710 - LAST ADDITION: 2014-11-02

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b12849
Chaperonin Group: I
Deposit Date: 2009-01-18
Type: fie
Type strain?: no
Genus: Unknown
Species: sp.
Strain: gamma proteobacterium NOR51-B
Lineage: root; cellular organisms; Bacteria; Proteobacteria; Gammaproteobacteria; unclassified Gammaproteobacteria
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: DS999411
Nucleotide Genbank gi: 219677714
Peptide Genbank Accession: EED36912
Peptide Genbank gi: 219680563
Best FASTA Match: b9336 Congregibacter litoralis KT71 (see fasta results)
Date of FASTA search: 2014-11-24
FASTA identity %: 79.700
Best BLASTP Match: b9336 Congregibacter litoralis KT71 (see blastp results)
Date of BLASTP search: 2014-11-24
BLASTP identity %: 88.649
Source: Genbank
Notes: -
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCAGCTAAAGACGTACATTTTGGAGACAAGGCGCGCCAGCAGATGCTGGTAGGCGTG
AATGTTCTCGCTGACGCCGTAAAGGCGACCCTCGGCCCCAAGGGTCGTAACGTAATCCTC
GAGAAGTCCTTCGGCGCGCCCACCGTGACCAAGGATGGTGTTTCCGTAGCCAAGGAAATC
GAACTCGCTGACCGCTTTGAGAACATGGGCGCTCAGATGGTCAAAGAAGTGGCTTCACAG
GCGTCTGACGCCGCTGGTGACGGCACCACGACAGCAACCGTGTTGGCCCAGTCGATTGTC
AACGAAGGGCTTAAGTCAGTGGCAGCGGGTATGAACCCGATGGATCTGAAGCGCGGTATC
GACAAGGCAGTGACAGCGGCGGTTGCCGCAGTGCAGGCCATGGCCACACCGTGTGAAGAC
AACAAAGCCATCGCCCAGGTAGGTACCATTTCTGCCAACAGCGACGTGTCCGTCGGTGAG
ATTATTGCTGACGCCATGGAAAAAGTAGGCAAGGAAGGCGTGATCACGGTTGAAGAAGGT
TCGGGTCTTGAGAACGAACTCGACGTCGTAGAGGGTATGCAGTTTGACCGCGGTTACCTC
TCGCCTTATTTCATCAACAACCAGGAGAGCATGCAGTGCGAACTTGAGGACCCATTCATC
TTGCTGGTGGATAAGAAGGTCTCGAATATTCGTGAGCTGCTTCCCCTGCTTGAGCAGGTA
GCCAAGGCGTCCAAGCCGCTGGTTATTGTCGCTGAAGATATCGAAGGTGAGGCCCTTGCC
ACGCTCGTTGTCAACAACATGCGCGGTATTGTTAAAGTCTCAGCCTGTAAGGCTCCGGGC
TTCGGCGACCGTCGTAAGGCCATGCTTCAGGACATCGCCATTCTCACCGGCGGCACCGTG
ATCTCCGAGGAAGTCGGTATGGACCTCGAGTCCACGACCCTTGAGCACCTCGGTAGTGCC
AAGCGTGTGACCATGGATAAAGACAACACGATCATTGTTGACGGTGCCGGTGATGCCGCT
GCCATCAGCAGCCGTGTTAACGAAATCCGTGTCCAGATCGAAAACACCTCTTCGGACTAC
GATCGCGAGAAGATGCAGGAACGTGTCGCCAAGCTCGCCGGCGGTGTTGCGGTGATCAAG
GTTGGCGCTGCTACTGAAATCGAGATGAAAGAGAAAAAGGCTCGGGTTGAAGACGCGCTG
CACGCGACACGCGCCGCTGTGGAAGAGGGCGTCGTCGCCGGTGGTGGTGTCGCTCTTATT
CGCGCTATCTCAGCGATCGCCGAGTTGACGGGTGACAACGAAGACCAGAACCACGGCATC
GCCGCTGCGCTTCGTGCCATGGAAGGTCCTCTGCGCCAGATCGTCGAAAACGCCGGCGAT
GAAGCTTCCGTGGTACTCGATAAGGTACGTCAGGGCGAAGGTAACTTCGGTTACAACGCC
GCGACCGGCGAATACGGCGACATGCTCGAGATGGGTATTCTCGACCCCGCCAAGGTGACC
CGTACTGCACTGCAGGCCGCGGGTTCGGTTGCCGCGCTGATGATCACCACCGAGGTGATG
ATCGCTGAGGCGCCCAAGGACGACGCAGCCCCCGCAATGCCCGATATGGGCGGCATGGGC
GGCATGGGCGGCATGATGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAAKDVHFGDKARQQMLVGVNVLADAVKATLGPKGRNVILEKSFGAPTVTKDGVSVAKEI
ELADRFENMGAQMVKEVASQASDAAGDGTTTATVLAQSIVNEGLKSVAAGMNPMDLKRGI
DKAVTAAVAAVQAMATPCEDNKAIAQVGTISANSDVSVGEIIADAMEKVGKEGVITVEEG
SGLENELDVVEGMQFDRGYLSPYFINNQESMQCELEDPFILLVDKKVSNIRELLPLLEQV
AKASKPLVIVAEDIEGEALATLVVNNMRGIVKVSACKAPGFGDRRKAMLQDIAILTGGTV
ISEEVGMDLESTTLEHLGSAKRVTMDKDNTIIVDGAGDAAAISSRVNEIRVQIENTSSDY
DREKMQERVAKLAGGVAVIKVGAATEIEMKEKKARVEDALHATRAAVEEGVVAGGGVALI
RAISAIAELTGDNEDQNHGIAAALRAMEGPLRQIVENAGDEASVVLDKVRQGEGNFGYNA
ATGEYGDMLEMGILDPAKVTRTALQAAGSVAALMITTEVMIAEAPKDDAAPAMPDMGGMG
GMGGMM
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCAACCGTGTTGGCCCAGTCGATTGTCAACGAAGGGCTTAAGTCAGTGGCAGCGGGTATG
AACCCGATGGATCTGAAGCGCGGTATCGACAAGGCAGTGACAGCGGCGGTTGCCGCAGTG
CAGGCCATGGCCACACCGTGTGAAGACAACAAAGCCATCGCCCAGGTAGGTACCATTTCT
GCCAACAGCGACGTGTCCGTCGGTGAGATTATTGCTGACGCCATGGAAAAAGTAGGCAAG
GAAGGCGTGATCACGGTTGAAGAAGGTTCGGGTCTTGAGAACGAACTCGACGTCGTAGAG
GGTATGCAGTTTGACCGCGGTTACCTCTCGCCTTATTTCATCAACAACCAGGAGAGCATG
CAGTGCGAACTTGAGGACCCATTCATCTTGCTGGTGGATAAGAAGGTCTCGAATATTCGT
GAGCTGCTTCCCCTGCTTGAGCAGGTAGCCAAGGCGTCCAAGCCGCTGGTTATTGTCGCT
GAAGATATCGAAGGTGAGGCCCTTGCCACGCTCGTTGTCAACAACATGCGCGGTATTGTT
AAAGTCTCAGCCTGT
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAQSIVNEGLKSVAAGMNPMDLKRGIDKAVTAAVAAVQAMATPCEDNKAIAQVGTIS
ANSDVSVGEIIADAMEKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNQESM
QCELEDPFILLVDKKVSNIRELLPLLEQVAKASKPLVIVAEDIEGEALATLVVNNMRGIV
KVSAC
Comments or questions...