cpnDB: A Chaperonin Database
December 22, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19735 - LAST ADDITION: 2014-12-07

RECORD DETAILS

For gi 221536776, see also: b13309

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b13308
Chaperonin Group: I
Deposit Date: 2009-02-01
Type: ref
Type strain?: no
Genus: Prochlorococcus
Species: marinus
Strain: MIT 9202
Lineage: root; cellular organisms; Bacteria; Cyanobacteria; Prochlorales; Prochlorococcaceae; Prochlorococcus
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: DS999537
Nucleotide Genbank gi: 221536776
Peptide Genbank Accession: EEE39609
Peptide Genbank gi: 221537156
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Prochlorococcus marinus MIT 9202 was isolated from the South Pacific Ocean at a depth of 79 meters.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCTAAAAGAATTATTTACAATGAGCAAGCTCGTAGAGCGCTCGAGAGAGGAATCGAT
ATCCTTGCTGAGTCTGTGGCTGTAACGCTTGGACCAAAAGGGAGAAATGTTGTACTAGAG
AAAAAATTTGGTGCTCCGCAAATCATCAATGATGGTGTCACAATCGCTAAAGAGATCGAA
TTAGAGGACCACATCGAAAATACAGGGGTTGCTTTAATCAGACAAGCCGCTTCAAAAACT
AATGATGCAGCTGGAGATGGTACAACAACAGCAACTGTTTTAGCTCATGCAATGGTTAAA
GCAGGGTTGAGAAACGTTGCTGCAGGAGCTAATGCAATTACCTTGAAAAAAGGAATTGAT
AAGGCTACTGAATTTCTAGTTGGTAAAATTCAGGATAATTCCAAACCTATAAGTGATAGT
AATGCTATTGCTCAATGTGGAACTATTGCTGCTGGAAATGACGAAGAAGTTGGCCAAATG
ATTGCCAATGCTATGGATAAAGTTGGTAAAGAAGGTGTTATCTCCTTAGAAGAAGGAAAA
TCAATGACTACTGAATTAGAAGTTACTGAGGGGATGCGTTTTGACAAAGGTTATATTTCA
CCTTACTTTGCAACTGATACAGAAAGAATGGAGGCTGTTTTAGATGAACCATATATCCTT
CTGACTGATAAAAAAATTGCTTTAGTGCAAGATTTAGTTCCTGTTTTGGAACAAATAGCT
AAAACTGGTAAACCACTAGTCATCATTGCAGAAGATATCGAAAAAGAGGCTTTAGCAACT
CTTGTTGTTAATAGATTGAGAGGGGTGTTAAATGTTGCGGCAGTTAAGGCTCCTGGATTT
GGCGATAGAAGAAAAGCTATGCTTGAAGACATGGCAGTTTTAACTAATGGACAACTTATC
ACGGAAGATGCAGGCTTGAAACTAGAAAATGCTACCCTAGATATGCTTGGAACTGGTAGA
AGAATTACTATCAATAAAGAGACTACGACTATTGTGGCGGAAGGTAATGAGCAAGCAGTT
AAGGCTAGATGTGATCAAATTAAGAAACAAATGGATGAAACAGATTCCTCATACGATAAA
GAAAAGCTTCAAGAACGCCTAGCTAAATTAGCTGGAGGTGTAGCAGTTATTAAGGTTGGG
GCTGCTACTGAAACTGAGATGAAGGATAAAAAACTTCGTCTTGAGGATGCTATCAATGCA
ACAAAAGCTGCTGTTGAAGAAGGAATTGTTCCTGGAGGAGGAACAACTTTAGCTCATTTA
TCCCCTATTTTAAAAGAATGGGCTGATAAAAATTTAAAAGGAGAGGAATTAATTGGAGCC
AATATTGTTGAAGCTTCACTTACTGCTCCTCTCATGAGAATTGCTGAGAATGCAGGTTCT
AATGGAGCTGTAATAGCTGAAAATGTAAAAACTAAACCCTTTAATGATGGATTCAACGCT
GCTACTGGGGAATATGTAGATATGTCCTCTGCTGGTATAGTTGATCCTGCAAAAGTTACA
CGTTCAGGATTACAAAATGCAGCTTCTATAGCCGGTATGGTTCTTACCACTGAATGTATA
GTTGCCGATTTGCCAGAGAAAAAAGATTCTGCTAGTCCAGCAGGTGCTCCGGGTATGGGC
GGTGACTTTGATTATTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAKRIIYNEQARRALERGIDILAESVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIE
LEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLRNVAAGANAITLKKGID
KATEFLVGKIQDNSKPISDSNAIAQCGTIAAGNDEEVGQMIANAMDKVGKEGVISLEEGK
SMTTELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIALVQDLVPVLEQIA
KTGKPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRRKAMLEDMAVLTNGQLI
TEDAGLKLENATLDMLGTGRRITINKETTTIVAEGNEQAVKARCDQIKKQMDETDSSYDK
EKLQERLAKLAGGVAVIKVGAATETEMKDKKLRLEDAINATKAAVEEGIVPGGGTTLAHL
SPILKEWADKNLKGEELIGANIVEASLTAPLMRIAENAGSNGAVIAENVKTKPFNDGFNA
ATGEYVDMSSAGIVDPAKVTRSGLQNAASIAGMVLTTECIVADLPEKKDSASPAGAPGMG
GDFDY
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCAACTGTTTTAGCTCATGCAATGGTTAAAGCAGGGTTGAGAAACGTTGCTGCAGGAGCT
AATGCAATTACCTTGAAAAAAGGAATTGATAAGGCTACTGAATTTCTAGTTGGTAAAATT
CAGGATAATTCCAAACCTATAAGTGATAGTAATGCTATTGCTCAATGTGGAACTATTGCT
GCTGGAAATGACGAAGAAGTTGGCCAAATGATTGCCAATGCTATGGATAAAGTTGGTAAA
GAAGGTGTTATCTCCTTAGAAGAAGGAAAATCAATGACTACTGAATTAGAAGTTACTGAG
GGGATGCGTTTTGACAAAGGTTATATTTCACCTTACTTTGCAACTGATACAGAAAGAATG
GAGGCTGTTTTAGATGAACCATATATCCTTCTGACTGATAAAAAAATTGCTTTAGTGCAA
GATTTAGTTCCTGTTTTGGAACAAATAGCTAAAACTGGTAAACCACTAGTCATCATTGCA
GAAGATATCGAAAAAGAGGCTTTAGCAACTCTTGTTGTTAATAGATTGAGAGGGGTGTTA
AATGTTGCGGCAGTT
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAHAMVKAGLRNVAAGANAITLKKGIDKATEFLVGKIQDNSKPISDSNAIAQCGTIA
AGNDEEVGQMIANAMDKVGKEGVISLEEGKSMTTELEVTEGMRFDKGYISPYFATDTERM
EAVLDEPYILLTDKKIALVQDLVPVLEQIAKTGKPLVIIAEDIEKEALATLVVNRLRGVL
NVAAV
Comments or questions...