cpnDB: A Chaperonin Database
September 21, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19673 - LAST ADDITION: 2014-08-17

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b5490
Chaperonin Group: I
Deposit Date: 2004-05-25
Type: ref
Type strain?: no
Genus: Rickettsia
Species: sibirica
Strain: 246
Lineage: root; cellular organisms; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Rickettsiaceae; Rickettsieae; Rickettsia
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AABW01000001
Nucleotide Genbank gi: 28261784
Peptide Genbank Accession: EAA26296
Peptide Genbank gi: 28262792
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: From whole genome shotgun sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCAACAAAACTTATTAAACACGGCTCAAAAGCTCGTGAGCAAATGTTAGAAGGCATT
GATATACTTGCAGATGCAGTAAAAGTTACTTTAGGTCCAAAAGGCAGAAATGTACTTATA
GAGCAATCATTCGGTTCACCTAAAATTACAAAAGATGGTGTGACGGTTGCAAAATCGATC
GAGTTAAAAGATAAAATTAGAAATGCGGGAGCTCAGCTATTAAAATCAGCTGCTACAAAA
GCTGCAGAAGTAGCCGGTGATGGTACTACTACAGCTACGGTACTTGCTAGAGCTTTGGCT
CGTGAGGGTAATAAGCTAGTAGCTGCCGGTTATAATCCTATGGATTTAAAGCGTGGTATG
GATTTAGCGGTAAACGCAGTAGTAGAAGAAATTAAAAAATCCAGTAAAAAAATCAATAGC
CAAGAGGAAATCGCACAAGTCGGTACTATCTCTTCAAACGGTGATAAGGAAATCGGTGAG
AAAATTGCTAAGGCAATGGAGGAAGTCGGTAAAGAAGGCGTGATAACCGTTGAAGAAGCA
AAGAATTTTAGCTTCGATGTTGAAGTAGTTAAAGGTATGATGTTTGATAGAGGTTATCTA
TCACCGTATTTTGTAACGAATTCTGAGAAAATGGTTGCTGAGCTTGAAAATCCTTTCATC
TTAATATTTGAGAAAAAATTATCAAATTTACAACCGATGTTACCTATACTTGAGGCTGTA
GTACAATCACAACGCCCTCTATTAATTATTGCTGAGGATGTTGAGGGCGAAGCTCTTGCA
ACGCTTGTAGTCAATAGATTACGTGGTGGTTTAAAAGTTGCGGCAGTAAAAGCTCCCGGT
TTTGGCGATAGAAGAAAAGCAATGATGGAAGATATTGCTATCCTAACTAAAGGTGAGCTT
ATTACTGAAGATTTAGGTATGAAGCTTGAAAATGTGAGTATTAAGAGTCTAGGGACAGCA
AAAAGAGTAACAATTTCTAAAGAAAATACCGTAATTGTTGACGGTAACGGTGATAAGAAA
AATATTGAAGATAGAGTATTACAAATTAAATCTCAAATAGCTGAAACTACTTCTGATTAT
GATAAAGAAAAACTGCAAGAGCGTTTAGCTAAACTTTCCGGTGGTGTTGCCGTATTAAAG
GTTGGCGGTGCTACGGAAGTTGAAGTGAAAGAGCGTAAAGATCGTGTTGAAGATGCACTT
GCTGCTACAAGAGCGGCAGTTGAGGAAGGTGTTGTTGCCGGTGGCGGTGTAACATTACTT
CATGCATCACAACCTTTAACAAAGCTTAAAGTAGAGAATAAGGATCAACAAGCAGGTATT
GAAATAGTAATAGAAGCTTTAAAGGATCCGTTAAAACAGATTGTTGAAAATGCTGGTGAA
AACGGTGGCGTAGTAGTTGGTAAATTACTAGAACATAAGGATAAAAATTATGGCTTTAAT
GCTCAAGATATGCAATATGTCGATATGATTAAAGCAGGAATTATTGATCCAGCTAAAGTA
GTGCGTACTGCACTTCAAGATGCTGCTTCCGTTGCTTCGTTAATTATTACCACGGAAACT
TTAATTGTTGACGAACCTTCTGATAAGGCAGAGCCAATGCCAATGCGTGGCGGTATGGGA
GGCATGGGCGGTATGGATTTCTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MATKLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSI
ELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGM
DLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEA
KNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILIFEKKLSNLQPMLPILEAV
VQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGFGDRRKAMMEDIAILTKGEL
ITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGNGDKKNIEDRVLQIKSQIAETTSDY
DKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDALAATRAAVEEGVVAGGGVTLL
HASQPLTKLKVENKDQQAGIEIVIEALKDPLKQIVENAGENGGVVVGKLLEHKDKNYGFN
AQDMQYVDMIKAGIIDPAKVVRTALQDAASVASLIITTETLIVDEPSDKAEPMPMRGGMG
GMGGMDF
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCTACGGTACTTGCTAGAGCTTTGGCTCGTGAGGGTAATAAGCTAGTAGCTGCCGGTTAT
AATCCTATGGATTTAAAGCGTGGTATGGATTTAGCGGTAAACGCAGTAGTAGAAGAAATT
AAAAAATCCAGTAAAAAAATCAATAGCCAAGAGGAAATCGCACAAGTCGGTACTATCTCT
TCAAACGGTGATAAGGAAATCGGTGAGAAAATTGCTAAGGCAATGGAGGAAGTCGGTAAA
GAAGGCGTGATAACCGTTGAAGAAGCAAAGAATTTTAGCTTCGATGTTGAAGTAGTTAAA
GGTATGATGTTTGATAGAGGTTATCTATCACCGTATTTTGTAACGAATTCTGAGAAAATG
GTTGCTGAGCTTGAAAATCCTTTCATCTTAATATTTGAGAAAAAATTATCAAATTTACAA
CCGATGTTACCTATACTTGAGGCTGTAGTACAATCACAACGCCCTCTATTAATTATTGCT
GAGGATGTTGAGGGCGAAGCTCTTGCAACGCTTGTAGTCAATAGATTACGTGGTGGTTTA
AAAGTTGCGGCAGTA
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLARALAREGNKLVAAGYNPMDLKRGMDLAVNAVVEEIKKSSKKINSQEEIAQVGTIS
SNGDKEIGEKIAKAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKM
VAELENPFILIFEKKLSNLQPMLPILEAVVQSQRPLLIIAEDVEGEALATLVVNRLRGGL
KVAAV
Comments or questions...