cpnDB: A Chaperonin Database
July 31, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19655 - LAST ADDITION: 2014-06-29

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b6895
Chaperonin Group: II
Deposit Date: 2004-11-01
Type: ref
Type strain?: no
Genus: Aspergillus
Species: nidulans
Strain: FGSC A4
Lineage: root; cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AACD01000007
Nucleotide Genbank gi: 29570860
Peptide Genbank Accession: EAA66480
Peptide Genbank gi: 40747324
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Nucleotide sequence extracted from genomic DNA sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCATCCTTCGCCAACCCCACACAGATCTTTGCGGACGATGTTATTGAGGAGAAAGGA
GAGAATGCACGTCTCTCGGCCTTCGTCGGCGCCATCGCCGTCGGAGATCTCGTTAAGAGC
ACATTAGGTCCCAAGGGCATGGACAAGATTTTACAATCAGCGTCCACCGGAGAAATACTC
GTTACAAACGACGGTGCCACGATCCTCAAAGCCATTGCCCTTGATAACGCCGCTGCAAAA
GTACTAGTCAACATTTCCAAGGTCCAGGATGACGAAGTTGGTGATGGGACAACCTCCGTG
ACGGTGTTGGCCGCCGAGCTGCTGCGGGAAGCCGAAAAGCTTGTCAACCGCAAGATTCAC
CCACAGACTATCATCGAAGGATACCGTATTGCCAGCCGTGCTGCCCTCGATGCTCTCGAC
AAGGTTGCTGTTGACCGCAGTGACGACATGGAGAAGTTCCGCAAAGACCTCCACTCGATT
GCCCGCACTACCCTCAGCTCTAAGGTCCTGGCCCAGGACCGCGACCAGTTCGCTGCTCTT
GCCTGCGATGCCGTTCTTCGACTTCGGGGCTCAACCGACTTGAGCCACATCCAGATCATC
AAAAAAGCCGGCGGAAAGCTCAGTGACTCTTACCTCGACGAGGGTTTCATTCTTGATAAG
AAGATTGGTGTCAACCAACCGAAGCGCCTGGAAAATGCTAAGATTCTTGTTGCAAACACA
GCGATGGACACAGATAAGGTGAAGATCTTCGGAGCGCGCGTGAAGGTCGAGTCAACAGGG
AAGTTGGCGGAATTGGAGAAGGCAGAGCGTGAGAAGATGAAGGCCAAGGTTGAGCGGATC
AAGGCACACGGGATCAACTGCTTTGTCAACCGACAACTCATTTACAACTGGCCCGAACAG
CTGTTCACCGAGGCTGGTATCATGTCAATCGAGCACGCCGACTTTGACGGCATTGAGCGA
CTGGCGCTGGTTACCGGTGGAGAGATCGCCTCGACTTTCGACCACCCCGACCAGGTCAAG
CTGGGGTCTTGTGACCTGATCGAGGAGGTCATTATTGGCGAAGATACCCTCATCAAATTC
TCCGGCGTAGCTGCTGGCCAAGCTTGCACAATCGTTCTCCGCGGCGCCACAGAGCAACTT
CTCGACGAAGCCGAGCGTTCGCTGCACGATGCTCTGGCAGTACTGTCTCAGACCGTCAAG
GATCCCCGAGTGACTCTTGGTGGTGGATGCGCAGAGATGGTCATGTCCAAGGCTGTCGAG
CAGGCTGCCCAGAACACCACGGGTAAGAAGCAACTTGCTGTCGATTCGTTCGCACATGCT
CTCAAGCAGCTTCCTACAATTTTGGCCGACAATGCCGGTCTCGATTCAAGTGACCTTGTT
ACCCGACTACGAACCGCGATCAACAACGGTATGACGAGCTCTGGGCTGGATCTGCTCACA
CCTGGCGGTGGCATTGCCGACATGCGCGAGTTGGGTGTTGTGGAGAGCTACAAATTGAAG
AAGGCTGTTGTGTCGTCTGCTTCGGAAGCAGCTGAGCTTCTCCTCCGTGTGGACAACATT
ATCCGCGCCGCTCCTCGTCGACGTGACCGGATGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MASFANPTQIFADDVIEEKGENARLSAFVGAIAVGDLVKSTLGPKGMKILQSASTGEILV
TNDGATILKAIALDNAAAKVLVNISKVQDDEVGDGTTSVTVLAAELLREAEKLVNRIHPQ
TIIEGYRIASRAALDALDKVAVDRSDDMEKFRKDLHSIARTTLSSKVLAQDRDQFAALAC
DAVLRRGSTDLSHIQIIKKAGGKLSDSYLDEGFILDKKIGVNQPKRLENAKILVANTAMD
TDKVKIFGARVKVETGKLAELEKAEREKMKAKVERIKAHGINCFVNRQLIYNWPEQLFTE
AGIMSIEHADFDGIERLALVTGGIASTFDHPDQVKLGSCDLIEEVIIGEDTLIKFSGVAA
GQACTIVLRGATEQLLDEAERSLHDALAVLSQVKDPRVTLGGGCAEMVMSKAVEQAAQNT
TGKKQLAVDSFAHALKQLPTILADNAGLDSSDLVTRLRTAINGMTSSGLDLLTPGGGIAD
MRELGVVESYKLKKAVVSSASEAAELLLRVDNIIRAAPRRRDRM
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...