cpnDB: A Chaperonin Database
July 24, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19655 - LAST ADDITION: 2014-06-29

RECORD DETAILS

For gi 297254944, see also: b16432

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b16431
Chaperonin Group: II
Deposit Date: 2010-02-21
Type: ref
Type strain?: yes
Genus: Staphylothermus
Species: hellenicus
Strain: -
Lineage: root; cellular organisms; Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales; Desulfurococcaceae; Staphylothermus
Original ID: DSM 12710
CUTC ID: -
Nucleotide Genbank Accession: CP002051
Nucleotide Genbank gi: 297254944
Peptide Genbank Accession: ADI32647
Peptide Genbank gi: 297256438
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Type strain synonyms P8 = DSM 12710 = JCM 10830.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCAGTTGAGCCTATGGGTATACCCGTACTTATACTTAAGGAGGGAACACAGAGAACA
GCTGGACGTGATGCTTTAAGAGCAAACATAATGGCTGCTCGAGCAGTTGCTGAAATGATT
AAGACAACCTATGGGCCTAAAGGCATGGATAAAATGCTTGTTGATGCATTAGGAGACGTA
ACAATTACAAATGATGGAGCAACTATACTGGACAAAGCAGAAATACAGCATTCAGCAGCT
AAGATGCTTGTTCAAATAGCTAAGAGCCAAGACTATGAAGTAGGAGACGGCACAAAGACT
GCTGTAATATTTGCTGGAGAACTATTAAGGCATGCTGAGGAACTACTAGATAAGAATATT
CACCCAACAATTATAGTTAGTGGATACAGGAAAGCATTGGAAGAAGCACTCAGCTTCCTA
TACCAAATCGCTGAACCCATAGACATTAATGACGATGAAACCCTCAAGAAAGTAGCTAGA
ACAGCATTAACAAGCAAAGCAGTACATGAGGCAAGAGAACACTTTGCAGAAATATCTGTA
AAAGCAGTTAAACTAATAGCTGAAAAGAGAGGCGATAAATACTATATAGACCTAGACAAT
GTGCAAATCATCAAGAAATATGGTGGAAGCCTGCTAGACTCACTCCTAGTTTACGGCATT
GTTCTTGACAAGGAAGTTGTTCATCCCGGCATGCCTAGAAGAGTTGAAAACGCAAAGATC
GCATTAATAGATGCACCATTAGAAATAGAGAAGCCCGAGATTGACGCAGAAATAAGAATA
ACAGATCCCAGCCAGCTTAGAGCATTTCTTAACCAGGAAGAAGAAATCCTGAAGAAAATG
GTTGATAAGATTGCTGGTACTGGTGCTAATGTTGTTATTTGTCAGAAGGGTATTGATGAA
GTAGCACAGCACTTCCTAGCAAAGAAAGGAATACTAGCAGTAAGAAGAGTAAAAAGATCA
GACATGGAAAAACTAGAAAAAGCAACAGGAGGAAGAATCATAAGCAACATCGACGATCTA
AAACCCGAGGATCTAGGAGAAGCCGAGCGCGTTGAGGAGAGAAAAGTCGGAGAAGACAAA
ATGGTCTTTGTAGAAGGATGCAAGAACCCCAAGGCTGTAAGCATCGTTATACGTGGAGGA
TTAGAGAGGCTAGTAGATGAAGCTGAGAGGAGTCTAAGAGATGCATTAGCAGCAACAGCA
GATGCTGTAAAAGATGGAAAAATCGTTGCAGGAGGTGGAGCGGTAGAAGTAGAACTAGCT
AAACACTTAAGAAAATACGCTAAAACTGTTGGCGGCAAAGAACAATTAGCTATAGAAGCT
TTCGCAAAATCACTAGAAGGATTAGCAATGGCTCTAGCTGAGAATGCAGGATTAGATCCA
ATCGAGATCATTATGAAGCTGAGAGCTGAACATGAGAAGGAAGAAGGTAAATGGATAGGT
GTTAACGTGTTTACTGGAGACCTTGCAAACATGATGGAGCTAGGCGTCATTGAGCCTGTG
AGTATAAAAGCTAATGCTATAAAATCAGGTGTTGAAGCGGCAACAATGATACTAAGAATA
GACGATGTAATATCTGCCAGCAAGATCGAGAAACCAGAGGAGACGGGTAAGAGGGGAGGA
GAAGAAGAGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAVEPMGIPVLILKEGTQRTAGRDALRANIMAARAVAEMIKTTYGPKGMDKMLVDALGDV
TITNDGATILDKAEIQHSAAKMLVQIAKSQDYEVGDGTKTAVIFAGELLRHAEELLDKNI
HPTIIVSGYRKALEEALSFLYQIAEPIDINDDETLKKVARTALTSKAVHEAREHFAEISV
KAVKLIAEKRGDKYYIDLDNVQIIKKYGGSLLDSLLVYGIVLDKEVVHPGMPRRVENAKI
ALIDAPLEIEKPEIDAEIRITDPSQLRAFLNQEEEILKKMVDKIAGTGANVVICQKGIDE
VAQHFLAKKGILAVRRVKRSDMEKLEKATGGRIISNIDDLKPEDLGEAERVEERKVGEDK
MVFVEGCKNPKAVSIVIRGGLERLVDEAERSLRDALAATADAVKDGKIVAGGGAVEVELA
KHLRKYAKTVGGKEQLAIEAFAKSLEGLAMALAENAGLDPIEIIMKLRAEHEKEEGKWIG
VNVFTGDLANMMELGVIEPVSIKANAIKSGVEAATMILRIDDVISASKIEKPEETGKRGG
EEE
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...