cpnDB: A Chaperonin Database
October 23, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19685 - LAST ADDITION: 2014-09-21

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b17432
Chaperonin Group: II
Deposit Date: 2010-06-24
Type: ref
Type strain?: no
Genus: Coprinopsis
Species: cinerea
Strain: okayama7#130
Lineage: root; cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetidae; Agaricales; Psathyrellaceae; Coprinopsis
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AACS02000003
Nucleotide Genbank gi: 298408986
Peptide Genbank Accession: EAU91603
Peptide Genbank gi: 116508708
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: -
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCGTCAAGCATAGAACTCATTAACCCCAAGGCCGAGAGCGTTCGTCGTGCAGCGGCG
CTCCAGGTCAACACCAATGGTGCCATGGGTTTGGCAGCAGTGGTCAAGGGTAACCTCGGC
CCAAGAGGAACTTTGAAGATGCTCGTCGATGGTGCCGGCCAGATCAAAATGACAAAAGAT
GGCAAAGTCCTCCTCACCGAGATGCAAATCCAAAACCCCACCGCCGCCATGATTGCCCGT
GCCGCCGTCGCCCAGGACGACCAAGTCGGCGACGGAACCACCTCTGTCGTTTTACTCGTC
GGTGAACTCTTGAAGCAAGCCGATCGGTATACATCTGAGGGCGTCCACCCGACCATCGTT
GCGGAAGGTTTCGATCTTGCAAAGAAAGAGGCTCTGAAGTTCTTGGACACTTTCAAAGTC
CCTACCAAGCCAGATCGAGCAACCTTGATTAACATCGCCAGAACGTCTCTGGATACCAAA
CTGTCCTCTGCATTGGCCAAACAGCTCGCTGCCGACGTTGTCGATGCCGTTCTCACTATC
CGTCAACCTCCTCCTCCAAGTGACGCGCTTAACCAGTGGAGAGAGCCCATCGACCTCCAC
ATGATCGAAATCATGAAAATGCAACATCGAACGGCATCCGACACTCAACTTGTCCGGGGC
CTCGTCCTCGATCACGGTGCTCGTCACCCCGACATGCCAAAGCGTGTCGAAAATGCGTAC
ATTCTCACCCTGAACGTCAGCTTGGAATACGAGAAAACCGAGGTCAACTCGAGCTTCTTC
TACTCCTCCGCTGAGCAGCGAGAGAAACTCGTCGAGTCCGAGCGCAGATTCACCGACGCA
AAGTGCAAAAAAATCGTCGAACTCAAAAATCTCGTCTGCGACCAAGCTGTTGGGTCGAAT
GAGAAGCCCAAGAACTTTGTCGTCATCAACCAGAAGGGTATCGATCCTCTCTCCCTCGAT
ATCTTTGCCAAGAATGGTATCATTGCGCTACGCCGCGCTAAGCGTCGAAACATGGAACGT
CTCCAATTGGTCTGCGGCGGTGTCGCACAGAACTCTGTCGACGATTTGACGCCAGATGTT
CTCGGCTGGGCTGGTTTGGTCTACGAACACACGCTGGGAGAAGAAAAGTACACATTTGTC
GAGGACGTCAAGCAGCCCAAGTCCGTCACTCTTCTTATCAAGGGCCCCAACCAGCACACC
ACACAACAAATTCAAGACGCCCTTCGAGATGGTCTTCGGGCTGTCAAGAACGCGATCGAG
GACGAGGCATTGATTCCAGGTGCCGGTGCTTTCGAGGTGGCCTGTTCGGCGCATTTGAGC
GGCCCTGTGAAGAAGGCTGCAAAGGGACGTGTCAAGATGGGTGTTCAGGCGTTCGCCGAC
GCATTGCTTGTCATTCCGAAGACCCTCGCTGCAAACGGCGGTTTCGACGTCCAGGATGCA
ATCGTCGCTCTTCAGGACGAACAGGCAGAAGGAAATGTTGTCGGCCTCGATCTCCAGTCA
GGCGAGCCGTTTGACCCAACGGTCGAGGGCATCTGGGACAACTACAGGGTGAAGAGGCAG
ATGCTCCACTCATGCTCTGTAATCGCCGTCAACCTTCTCTCAACCGACGAGATCTTGCGT
GCAGGGCGCAGTTCGTTGAAGCCTGACGGCCAATAG
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MASSIELINPKAESVRRAAALQVNTNGAMGLAAVVKGNLGPRGTLKMLVDGAGQIKMTKD
GKVLLTEMQIQNPTAAMIARAAVAQDDQVGDGTTSVVLLVGELLKQADRYTSEGVHPTIV
AEGFDLAKKEALKFLDTFKVPTKPDRATLINIARTSLDTKLSSALAKQLAADVVDAVLTI
RQPPPPSDALNQWREPIDLHMIEIMKMQHRTASDTQLVRGLVLDHGARHPDMPKRVENAY
ILTLNVSLEYEKTEVNSSFFYSSAEQREKLVESERRFTDAKCKKIVELKNLVCDQAVGSN
EKPKNFVVINQKGIDPLSLDIFAKNGIIALRRAKRRNMERLQLVCGGVAQNSVDDLTPDV
LGWAGLVYEHTLGEEKYTFVEDVKQPKSVTLLIKGPNQHTTQQIQDALRDGLRAVKNAIE
DEALIPGAGAFEVACSAHLSGPVKKAAKGRVKMGVQAFADALLVIPKTLAANGGFDVQDA
IVALQDEQAEGNVVGLDLQSGEPFDPTVEGIWDNYRVKRQMLHSCSVIAVNLLSTDEILR
AGRSSLKPDGQ
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...