cpnDB: A Chaperonin Database
October 31, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19692 - LAST ADDITION: 2014-10-28

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b6931
Chaperonin Group: II
Deposit Date: 2004-11-01
Type: ref
Type strain?: no
Genus: Cryptosporidium
Species: parvum
Strain: Iowa type II
Lineage: root; cellular organisms; Eukaryota; Alveolata; Apicomplexa; Coccidia; Eucoccidiorida; Eimeriorina; Cryptosporidiidae; Cryptosporidium
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AAEE01000005
Nucleotide Genbank gi: 46227685
Peptide Genbank Accession: EAK88881
Peptide Genbank gi: 46227961
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Chromosome 2. Nucleotide sequence extracted from whole genome shotgun DNA sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGTTGGCAAAACCATCTCAGGATCAATCAATTCACGGAGAGCGACAACATGGGAGTGAT
GTGAGGTCTAATAATTTGACAGCAGTAATGTCGATAGCAAATATATTAAAGTCGTCATTG
GGACCCCAAGGGTTGGATAAGATGCTTGTTGATGAGGTGGGCGAAGTAATAGTAACTAAT
GATGGTGCTACAATTTTAAGCCAATTGGAAGTAAAGCACCCAGCTGGGCGAGTACTAGTA
GATTTGAGTGAGCTACAGGACAAGGAAGTGGGGGATGGCACAACATCTGTAGTTTTATTA
GCTGCTGAGTTACTAAGGAGAGGTACATCTTTAGTTAGCAATGGGTCTCATCCTTCAAAT
GTAATTTCTGGTTATAAGTTGGCTCTAAAGGAGTGTGTGAGATATATTTCTGGGTCTTTA
TCTATTAATGAGACAATTAGTGAGGAATGCTGCCTTAATGTTGCTAAAACTGTGCTATCA
TCAAAGCTAGCAGGAGCAGACTCAGAGTTTTTTGGGAAGTTGGTAGTAGATTCAATAATG
ACAGTAAAGGCTACAGACCCCTTAACAGGAGCTGTCAAGTATCCAGTAAAATCTTTGAAC
ATATTAAAAACTCATGGTAAAGGTTTATCAGAGTCATTTTTGGTTGAGGGTTATGCTCTC
TCCCATACAGGTAGAGCTTGCCAGGGAATGCCAACGTCTGTAAAAAATGTCAAAATTGCA
TGTATAGACTTTCCTTTAAAACAATACAGAATGCAAATGGGTATTCGTGTTGAATTGGAA
GATCCAAAAGAACTTGCAAGGATTAGACTGGAAGAGAAGGAAGTAATTCACAAACGTATT
GAAAAGATTTTGGCTACAGGTTGTAATGTAGTTTTGACTTCAGGGGGTATTGATGATCAA
TGCATGAAATATTTTGTCTCAGCTGGTTGTATTGCAGTTAGAAGGGTAGAGAAGGTTGAT
TTAAGAAGAATTGCCAAGGCAACAGGAGCGACAATCTGCCTTACAATGGCACAATTAGAG
GATTCAGAGGAATCATTTGACCCGGCTTATCTTGGAGAATGCCAAGAAGTAAGAGAAGAA
CGTATTGGAGACACTGATTATATGATGTTCCTTGGTTGCAAGACTCATAGAGCAGCCTCA
ATTGTATTAAGAGGAGCAAATGAGGTTCTATTAGATGAGCTTGAGCGCTCTCTAAATGAT
GCTTTGTGTTCCGTATCTAAGCTTTTAGAGTCAAATGGATATGTTGCAGGAGGAGGAGCA
GTGGAGGCTGCTTTGAGTATTTACTTAGAAGACTTTGCTCGCACTCTTGGGTCTAGAGAA
CAGCTTGCAATTGCGGAATTTGCTGAGGCACTTTTGGTTATTCCTAAAACTTTGGCAATT
AATTCCGCTAAAGATGCAACAGACTTGGTTGCTAGACTTAGAGCATACCATGCAAGCGCC
CAACAAGGACAACTCAATAACTATGCTACTAAACCAACTTCTTCAGATTTAACAGTAAAA
TCTCAAGATCAAGATAAATACAAATTTTTTGGGCTTGATTTAATTAATGGAACAGTAAGA
GATAATGTCCAAGCAGGAGTTTTGGAACCAACTATCAGCAAACTTAAGTCTTTAAGATTT
GCAACAGAAGCTGCAATCACGCTTCTCCGTATTGATGACTACATTAAAGTAAAACCCGTA
GAGAACCAACAAGGAAACGAGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MLAKPSQDQSIHGERQHGSDVRSNNLTAVMSIANILKSSLGPQGLDKMLVDEVGEVIVTN
GATILSQLEVKHPAGRVLVDLSELQDKEVGDGTTSVVLLAAELLRRGTSLVSNGSHPSNV
ISGYKLALKEVRYISGSLSINETISEECCLNVAKTVLSSKLAGADSEFFGKLVVDSIMTV
KATDPLTGAVKYPVKSLNILKHGKGLSESFLVEGYALSHTGRACQGMPTSVKNVKIACID
FPLKQYRMQMGIRVELEDPKELARIRLEKEVIHKRIEKILATGCNVVLTSGGIDDQCMKY
FVSAGCIAVRRVEKVDLRRIAKATGATICLTMAQLEDSESFDPAYLGECQEVREERIGDT
DYMMFLGCKTHRAASIVLRGANEVLLDELERSLNDALCSVSKLLESGYVAGGGAVEAALS
IYLEDFARTLGSREQLAIAEFAEALLVIPKTLAINSAKDATDLVARLRAYHASAQQGLNN
YATKPTSSDLTVKSQDQDKYKFFGLDLINGTVRDNVQAGVLEPTISKLKSLRFATEAAIT
LLRIDDIKVKPVENQQGNE
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...