cpnDB: A Chaperonin Database
April 23, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19501 - LAST ADDITION: 2014-04-18

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b7190
Chaperonin Group: II
Deposit Date: 2004-11-01
Type: ref
Type strain?: no
Genus: Candida
Species: albicans
Strain: SC5314
Lineage: root; cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; mitosporic Saccharomycetales; Candida
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AACQ01000025
Nucleotide Genbank gi: 46442044
Peptide Genbank Accession: EAL01391
Peptide Genbank gi: 46442099
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Chromosome 4. cct-4. Nucleotide sequence is derived from whole genome shotgun DNA sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCATCAGTTGCAAGACCAGCAGTAGCACCTTCCAATGCTACTTTTAAAGATAAAGAA
AAACACAAGAAGTTCGTAAAGCCAACATTCTTGCTGCTAGAGCTGTATCAGATGCAATTC
GTACATCCTTGGGCCTAAAGGGATGGACAAAATGATCAGAACCAAAAATGGAGAAATCAT
TATATCAAACGATGGAGCAACCTTTTGAAGCATATGGCGGTTTTACATCCTGCCGCTAGA
ATGTTAGTCGATGTAAGTCATGCCCAAGATGTGAAGCCGGAGATGGTACCACCACCGTTG
CCATCTTGACAGGTGCATTTTTGGGTGCAGCAGAACGATATTAAGTAAAGGAATCCATCC
AACTTTAATTGCTGAATCTTTCCAAAGAGCAGCTCAACGTTCAGTTGAAATTTGTTAGAT
ATGTCATATAAAATAAGTTTGGATAACCGTGAACAATTGATCCGTGCTGCCACTACTTCT
TAAGTTCAAAAATTGTCTCACAACACTCACAATTATTGGCTCCTTTAGCTGTTGATTCTG
TATTAAAAGTATAAATGAAGAAGAAATTAGTAGTGGCCCTGATGAAACTATTATGAAGAA
AAATGTCGATTTAAATGTATTAGATTGATTAAAAAAGTCGGCGGTACCATCGATGATACT
CATTTAGTTAATGGGATTGTATTGACCAAAATGTCGTTAAACACGCTGGAGGACCTGTAC
GTGTGGAAAAAGCCAAAATTGGGTTGATCCAATTCAAATATCTCCTCCTAAACCAGATAT
GGAAAATAATGTTGTGGTTAATGATTATCGACAAATGGATAAAATTTAAAAGAAGAGAGA
GCTTATTTATTGAATATTTGTAAAAAAATTAAAAAGGCCAAATGTAATGTGTTTTGATCC
AAAAATCCATCCTTAGAGATGCTGTCAATGATTTAGCATTACATTTCTTGTCAAAATTAA
ACATATGGTTATTAAAGATATTGAAAGAGACGAAGTAGAATTTTTGTCAAAAGCCATTGG
ATGTAAACCAATGCTGACATTGATAACTTTACTGAAGATAGATTAGGTACTGCTGACTTA
ATTGAAGAACTTGATAGTTCGGTTCTAAAATTGTTGAAATCACTGGTGTGACTTCCAAAA
ATATTAAACCAACAGTTTCTGTCATTATAAAGGGGCAAATAACTTGGTTCTTGATGAAAC
TGAAAGATCTTTACACGATGCCTTGTGTGTTATTAGATTTTGGTCAAACAACAGGCTTTA
ATTGCTGGTGGTGGTGCTCCAGAAATCGAAGTTTCTAGACAATTGAGAAAGAAGCCAATA
AATTATCCGGGGTGGAACAATTTGTTTATAAAGAATTTGCTCAAGCTCTAGAAGTTTCCC
AACAACACTTGCTGAAAATGCTGGGTTGAATCCAATAAATGTTGTTACAGATTTGAGAAA
TAGACCGAAAATGGCGAAAAAGATGCTGGTATTTCTGTTAGAAGATCTGGCGCTTCAAAC
ACTTATGATGAACTGTATTGCAACCAGTATTGGTAAGTACAAGTGCCATCGTATTGGCAT
CTGAATGTGTCAAATCGATATTAGAATCGATGATATCCAATTTAGTCGTTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MASVARPAVAPSNATFKDKEKPQEVRKANILAARAVSDAIRTSLGPKGMDKMIRTKNGEI
IISNDGATILKHMAVLHPAARMLVDVSHAQDVEAGDGTTTVAILTGAFLGAAERLLSKGI
HPTLIAESFQRAAQRSVEILLDMSYKISLDNREQLIRAATTSLSSKIVSQHSQLLAPLAV
DSVLKVINEEEISSGPDETMKKNVDLNDIRLIKKVGGTIDDTHLVNGIVLTQNVVKHGGP
VRVEKAKIGLIQFQISPPKPDMENNVVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLL
IQKSILDAVNDLALHFLSKLNIMVIKDIERDEVEFSKAIGCKPIADIDNFTEDRLGTADL
IEELDSSGSKIVEIGVTSKNIKPTVSVIIRGANNLVLDETERHDALCVIRCLVKQQALIA
GGGAPEIEVSRQLMKEANKSGVEQFVYKEFAQALEVIPTTLAENAGLPINVVTDLRNRHE
NGEKDAGISVRRSGASNTYDEHVLQPVVSTSAIVLASECVKSILRIDDIQFSR
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...