cpnDB: A Chaperonin Database
October 26, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19685 - LAST ADDITION: 2014-09-21

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b6878
Chaperonin Group: I
Deposit Date: 2004-10-27
Type: ref
Type strain?: no
Genus: Phanerochaete
Species: chrysosporium
Strain: RP-78
Lineage: root; cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Basidiomycota; Hymenomycetes; Homobasidiomycetes; Aphyllophorales; Corticiaceae; Phanerochaete; Phanerochaete chrysosporium
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AADS00000000
Nucleotide Genbank gi: 46851932
Peptide Genbank Accession: -
Peptide Genbank gi: -
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Causative agent of white rot. Extracted from whole genome shotgun reads. Peptide sequence is translation of available DNA sequence (see http://genome.jgi-psf.org/whiterot1/whiterot1.home.html for further information).
Full Nucleotide Sequence: -
Full Peptide Sequence: -
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCCACTGTTCTTGCTCGTGCCATCTACTCTGAGGGTGTCAAGAACGTCGCTGCTGGTTGC
AACCCGATGGACCTTCGCCGTGGTTCGCAGGCAGCCGTCGACCGTGTCGTTGAGTTCCTC
TCTTCGCAGGCGAAGACCATCACCACCACCGCCGAGATTGCGCAGGTGGCTACTATCTCT
GCGAACGGCGACACTCACGTCGGCAACCTCATTGCCCAGGCTATGGAGAAGGTCGGCAAG
GAGGGTGTGATCACCGTGAAGGAGGGCCGCACCATCGAGGACGAGATCGAGATCACCGAG
GGCATGCGCTTTGACCGCGGCTTTACCTCCCCGTACTTCGTCACCGACGTCAAGACCCAG
AAGGTCGAGTTCGAGAAGCCCCTCATCCTCCTGAGCGAGAAGAAGATCTCTGCCCTCCAG
GACATCCTTCCCTCTCTCGAGATCGCCGCGCAGCAGCGCCGCCCGCTCCTCGTCATTGCC
GAGGACGTCGATGGTGAGGCCCTCGCTGCCTGCATTCTCAACAAGCTCCGTGGCCAGCTC
CAGGTTTGCGTTGTC
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLARAIYSEGVKNVAAGCNPMDLRRGSQAAVDRVVEFLSSQAKTITTTAEIAQVATIS
ANGDTHVGNLIAQAMEKVGKEGVITVKEGRTIEDEIEITEGMRFDRGFTSPYFVTDVKTQ
KVEFEKPLILLSEKKISALQDILPSLEIAAQQRRPLLVIAEDVDGEALAACILNKLRGQL
QVCVV
Comments or questions...