cpnDB: A Chaperonin Database
July 30, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19655 - LAST ADDITION: 2014-06-29

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b3154
Chaperonin Group: I
Deposit Date: 2002-07-08
Type: ref
Type strain?: no
Genus: Escherichia
Species: coli
Strain: K12
Lineage: root; cellular organisms; Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: NC_000913
Nucleotide Genbank gi: 49175990
Peptide Genbank Accession: NP_418567
Peptide Genbank gi: 16131968
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: -
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCAGCTAAAGACGTAAAATTCGGTAACGACGCTCGTGTGAAAATGCTGCGCGGCGTA
AACGTACTGGCAGATGCAGTGAAAGTTACCCTCGGTCCAAAAGGCCGTAACGTAGTTCTG
GATAAATCTTTCGGTGCACCGACCATCACCAAAGATGGTGTTTCCGTTGCTCGTGAAATC
GAACTGGAAGACAAGTTCGAAAATATGGGTGCGCAGATGGTGAAAGAAGTTGCCTCTAAA
GCAAACGACGCTGCAGGCGACGGTACCACCACTGCAACCGTACTGGCTCAGGCTATCATC
ACTGAAGGTCTGAAAGCTGTTGCTGCGGGCATGAACCCGATGGACCTGAAACGTGGTATC
GACAAAGCGGTTACCGCTGCAGTTGAAGAACTGAAAGCGCTGTCCGTACCATGCTCTGAC
TCTAAAGCGATTGCTCAGGTTGGTACCATCTCCGCTAACTCCGACGAAACCGTAGGTAAA
CTGATCGCTGAAGCGATGGACAAAGTCGGTAAAGAAGGCGTTATCACCGTTGAAGACGGT
ACCGGTCTGCAGGACGAACTGGACGTGGTTGAAGGTATGCAGTTCGACCGTGGCTACCTG
TCTCCTTACTTCATCAACAAGCCGGAAACTGGCGCAGTAGAACTGGAAAGCCCGTTCATC
CTGCTGGCTGACAAGAAAATCTCCAACATCCGCGAAATGCTGCCGGTTCTGGAAGCTGTT
GCCAAAGCAGGCAAACCGCTGCTGATCATCGCTGAAGATGTAGAAGGCGAAGCGCTGGCA
ACTCTGGTTGTTAACACCATGCGTGGCATCGTGAAAGTCGCTGCGGTTAAAGCACCGGGC
TTCGGCGATCGTCGTAAAGCTATGCTGCAGGATATCGCAACCCTGACTGGCGGTACCGTG
ATCTCTGAAGAGATCGGTATGGAGCTGGAAAAAGCAACCCTGGAAGACCTGGGTCAGGCT
AAACGTGTTGTGATCAACAAAGACACCACCACTATCATCGATGGCGTGGGTGAAGAAGCT
GCAATCCAGGGCCGTGTTGCTCAGATCCGTCAGCAGATTGAAGAAGCAACTTCTGACTAC
GACCGTGAAAAACTGCAGGAACGCGTAGCGAAACTGGCAGGCGGCGTTGCAGTTATCAAA
GTGGGTGCTGCTACCGAAGTTGAAATGAAAGAGAAAAAAGCACGCGTTGAAGATGCCCTG
CACGCGACCCGTGCTGCGGTAGAAGAAGGCGTGGTTGCTGGTGGTGGTGTTGCGCTGATC
CGCGTAGCGTCTAAACTGGCTGACCTGCGTGGTCAGAACGAAGACCAGAACGTGGGTATC
AAAGTTGCACTGCGTGCAATGGAAGCTCCGCTGCGTCAGATCGTATTGAACTGCGGCGAA
GAACCGTCTGTTGTTGCTAACACCGTTAAAGGCGGCGACGGCAACTACGGTTACAACGCA
GCAACCGAAGAATACGGCAACATGATCGACATGGGTATCCTGGATCCAACCAAAGTAACT
CGTTCTGCTCTGCAGTACGCAGCTTCTGTGGCTGGCCTGATGATCACCACCGAATGCATG
GTTACCGACCTGCCGAAAAACGATGCAGCTGACTTAGGCGCTGCTGGCGGTATGGGCGGC
ATGGGTGGCATGGGCGGCATGATGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGI
DKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDG
TGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAV
AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTV
ISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALI
RVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVKGGDGNYGYNA
ATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGG
MGGMGGMM
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCAACCGTACTGGCTCAGGCTATCATCACTGAAGGTCTGAAAGCTGTTGCTGCGGGCATG
AACCCGATGGACCTGAAACGTGGTATCGACAAAGCGGTTACCGCTGCAGTTGAAGAACTG
AAAGCGCTGTCCGTACCATGCTCTGACTCTAAAGCGATTGCTCAGGTTGGTACCATCTCC
GCTAACTCCGACGAAACCGTAGGTAAACTGATCGCTGAAGCGATGGACAAAGTCGGTAAA
GAAGGCGTTATCACCGTTGAAGACGGTACCGGTCTGCAGGACGAACTGGACGTGGTTGAA
GGTATGCAGTTCGACCGTGGCTACCTGTCTCCTTACTTCATCAACAAGCCGGAAACTGGC
GCAGTAGAACTGGAAAGCCCGTTCATCCTGCTGGCTGACAAGAAAATCTCCAACATCCGC
GAAATGCTGCCGGTTCTGGAAGCTGTTGCCAAAGCAGGCAAACCGCTGCTGATCATCGCT
GAAGATGTAGAAGGCGAAGCGCTGGCAACTCTGGTTGTTAACACCATGCGTGGCATCGTG
AAAGTCGCTGCGGTT
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTIS
ANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETG
AVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIV
KVAAV
Comments or questions...