cpnDB: A Chaperonin Database
July 30, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19655 - LAST ADDITION: 2014-06-29

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b5718
Chaperonin Group: I
Deposit Date: 2004-06-28
Type: ref
Type strain?: no
Genus: Staphylococcus
Species: aureus
Strain: subsp. aureus MRSA252
Lineage: root; cellular organisms; Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: BX571856
Nucleotide Genbank gi: 49240382
Peptide Genbank Accession: CAG41097
Peptide Genbank gi: 49242384
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Clinical strain of S. aureus. From complete genome sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGTTAAACAATTGAAATTCTCTGAAGATGCACGTCAAGCAATGTTACGTGGTGTTGAC
CAATTAGCAAATGCAGTTAAAGTAACGATTGGTCCTAAAGGACGTAATGTTGTATTAGAT
AAAGAGTTTACAGCACCTTTAATTACGAACGATGGTGTAACGATTGCTAAAGAAATCGAA
TTAGAAGATCCATATGAAAATATGGGGGCTAAACTAGTTCAAGAAGTCGCAAATAAGACA
AATGAAATTGCTGGTGACGGTACGACAACTGCAACAGTATTAGCTCAAGCAATGATTCAA
GAAGGCTTGAAAAATGTTACAAGTGGTGCAAACCCAGTTGGTTTACGACAAGGTATCGAC
AAAGCAGTTAAAGTTGCTGTTGAAGCGTTACATGAAAATTCTCAAAAAGTTGAAAATAAA
AATGAAATTGCGCAAGTAGGTGCGATTTCAGCAGCAGATGAAGAAATTGGACGCTATATT
TCAGAAGCTATGGAAAAAGTAGGTAACGATGGTGTCATTACAATTGAAGAATCAAATGGC
TTGAACACTGAACTTGAAGTGGTTGAAGGTATGCAATTTGATCGTGGTTATCAATCACCG
TATATGGTTACTGATTCAGATAAAATGGTTGCTGAATTAGAACGCCCATATATTTTAGTA
ACAGATAAAAAAATCTCTTCTTTCCAAGATATCTTACCTTTATTAGAACAAGTGGTTCAA
TCTAATCGTCCAATCTTAATTGTAGCTGATGAAGTTGAAGGCGATGCATTAACAAATATC
GTGCTAAACCGTATGCGTGGCACATTTACAGCTGTTGCAGTAAAAGCACCTGGTTTCGGT
GATCGTCGTAAAGCAATGTTAGAAGATTTAGCTATTTTAACTGGTGCGCAAGTGATTACA
GATGATTTAGGCTTAGACCTTAAAGATGCAACGATTGATATGTTAGGTACTGCAAGTAAA
GTAGAAGTTACTAAAGATAATACAACTGTTGTAGATGGTGACGGTGACGAAAACAGCATT
GATGCACGTGTAAGCCAATTGAAATCTCAAATTGAAGAAACTGAATCTGACTTTGATCGT
GAAAAATTACAAGAACGCTTAGCTAAATTAGCAGGCGGTGTTGCAGTTATCAAGGTAGGT
GCAGCAAGTGAAACAGAACTTAAAGAACGTAAATTACGTATCGAAGATGCTTTAAACTCT
ACACGTGCAGCAGTTGAAGAAGGTATTGTTGCAGGTGGTGGTACTGCACTAGTAAATGTT
TACCAAAAAGTAAGTGAAATTGAAGCTGAAGGCGACATTGAAACAGGTGTGAATATTGTA
CTTAAAGCATTAACTGCACCAGTTCGTCAAATTGCTGAAAATGCAGGATTAGAAGGCTCT
GTCATCGTTGAACGCTTGAAAAATGCAGAACCAGGTGTTGGTTTTAATGCTGCTACAAAC
GAGTGGGTTAATATGTTAGAAGTAGGTATCGTTGATCCAACTAAAGTAACACGCTCAGCA
TTACAACATGCAGCAAGTGTTGCGGCAATGTTCTTAACAACTGAAGCGGTTGTGGCATCA
ATTCCAGAAAAAAATAATGACCAACCTAACATGGGTGGCATGCCAGGAATGATGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIE
LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGID
KAVKVAVEALHENSQKVENKNEIAQVGAISAADEEIGRYISEAMEKVGNDGVITIEESNG
LNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQ
SNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVIT
DDLGLDLKDATIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDR
EKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNV
YQKVSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLEGSVIVERLKNAEPGVGFNAATN
EWVNMLEVGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQPNMGGMPGMM
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCAACAGTATTAGCTCAAGCAATGATTCAAGAAGGCTTGAAAAATGTTACAAGTGGTGCA
AACCCAGTTGGTTTACGACAAGGTATCGACAAAGCAGTTAAAGTTGCTGTTGAAGCGTTA
CATGAAAATTCTCAAAAAGTTGAAAATAAAAATGAAATTGCGCAAGTAGGTGCGATTTCA
GCAGCAGATGAAGAAATTGGACGCTATATTTCAGAAGCTATGGAAAAAGTAGGTAACGAT
GGTGTCATTACAATTGAAGAATCAAATGGCTTGAACACTGAACTTGAAGTGGTTGAAGGT
ATGCAATTTGATCGTGGTTATCAATCACCGTATATGGTTACTGATTCAGATAAAATGGTT
GCTGAATTAGAACGCCCATATATTTTAGTAACAGATAAAAAAATCTCTTCTTTCCAAGAT
ATCTTACCTTTATTAGAACAAGTGGTTCAATCTAATCGTCCAATCTTAATTGTAGCTGAT
GAAGTTGAAGGCGATGCATTAACAAATATCGTGCTAAACCGTATGCGTGGCACATTTACA
GCTGTTGCAGTA
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAIS
AADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMV
AELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFT
AVAV
Comments or questions...