cpnDB: A Chaperonin Database
December 20, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19735 - LAST ADDITION: 2014-12-07

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b6928
Chaperonin Group: II
Deposit Date: 2004-11-01
Type: ref
Type strain?: no
Genus: Cryptococcus
Species: neoformans
Strain: var. neoformans B-3501A
Lineage: root; cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AAEY01000042
Nucleotide Genbank gi: 50256293
Peptide Genbank Accession: EAL19134
Peptide Genbank gi: 50256409
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Chromosome 8. Nucleotide sequence extracted from whole genome shotgun DNA sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGTCCAGCATAGAACTCATAAACCCAAAAGCTGAGAGTTTGAGGAGGACGCAGGCTCTC
CAGGTCAACACTGCGGGCGCCGTTGGTCTTGCGAATGTCGTCAAGTCCAATCTCGGTCCT
AGAGGAACGATCAAAATGTTGGTGGACGGCTCTGGACAAATTAAGATGACCAAGGACGGT
AAAGTCCTTCTGTCCGAGATGCAGATCCAGAACCCCACTGCCGCTATGATTGCTCGAACC
GCTGTGGCGCAGGATGAGCAATGCGGCGATGGCACAACGTCGGTTGTTCTTCTCGTCGGA
GAACTTTTGAAGCAGGCGGACAGATACATCCAGGAAGGTGTTCACCCACGAGTGATTGGA
GATGGTTTCGACATTGCTAAGAAGGAAGCGTTGAACTTCCTTGACACTTTCAAGCAAACC
CCTAAACTCGACCGTGCCAACCTCATTTCTGTTGCCCACACCTCCCTTGCTACGAAGCTC
CACGCCAAACTCGCTCAAAAACTCTCCGCGGATGTTGTCGATGCTGTCCTTGCCATCCAG
CCTCCTGAAGTCACCGAACCTGGAGCTTATCGAGAACCCATTGACCTGCATATGATTGAA
GTGATGAAGATGCAACACAAGACCGACACAGACACCCAGTTGATTAGGGGATTGGTTATG
GACCATGGTGCTAGACATCCCGACATGCCCAAGCGGGTGGAGAACGCCTACATCTTGACG
CTCAATGTTTCCCTTGAGTACGAGAAGACCGAGGTCAACTCAGGCTTCTTCTATTCCTCA
GCGGAGCAAAGGGAAAAGCTCGTTGAGTCTGAAAGACGATTCGTTGACTCTAAGCTTAAG
AAAATTGTTGAGCTCAAGAACGCTGTGTGTGACGTGGCTGTTGGATCAAATGAGAAACCC
AAGAATTTCGTTGTGATCAACCAAAAGGGTATCGATCCGATGAGCTTGGATGTCCTCGCT
AAGAACGGTATTCTCGCTTTAAGGCGTGCGAAGAGAAGGAACATGGAGCGATTACAATTT
GCATGTGGCGGTGTCGCTCAAAATTCCGTCGAGGATTTGACCCCAGATGTCCTTGGTTGG
GCCGGTCTTGTCTACGAGCACACTCTAGGTGAAGAAAAGTATACTTTTGTGGAGGATGTG
AAGGAACCAAAGTCCGTCACCATGCTCATTAAAGGTCCCAACGCGCATACCATGACTCAG
ATTCAAGATGCTCTTCGAGACGGTTTCCGTTCCATCAAGAATGCCATCGAAGACAACTCT
GTTATTCCAGGTGCGGGTGCGTTCGAGCTCGCCTGCTCAGCGCATCTCAATTCTTCCTTA
AAGACTCTCGCCAAGGGCCGAGCCAAGCTGGGTGTCCAGGCTTTCGCTGAGGCTATGCTT
GTAATCCCTAAGACTCTTGCCGCGAACGGAGGATACGACGTGCAGGATGCCATCGTGGGT
TTGCAACAAGAGTTGGAGGAGGCCGGTGAGGATGGTGTCGTGGGTTTGGATTTGAAGAGT
GGAGAGCCAATGGACCCTGTTGTCGAAGGTGTATGGGATAACTACAGAGTGAAGAGGCAA
ATGTTGCACGGAGCGGCGACTATTGCTGTGAACTTGTTGAATGTCGACGAAGTGCTTAGG
GCAGGAAGATCATCGCTCAAAGAGGGCCCTGGTCCTTAG
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MSSIELINPKAESLRRTQALQVNTAGAVGLANVVKSNLPRGTIKMLVDGSGQIKMTKDGK
VLLSEMQIQNPTAAMIARTAVAQDEQCGDGTTSVVLLVGELLKQADRIQEGVHPRVIGDG
FDIAKKEALNFLDTFKQTPKLDRANLISVAHTSLATKLHAKLAQKLSADVVDAVLAIPPE
VTEPGAYREPIDLHMIEVMKMQHKTDTDTQLIRGLVMDHGARHPDMPKRVENAYILTLNV
SLEYETEVNSGFFYSSAEQREKLVESERRFVDSKLKKIVELKNAVCDVAVGSNEKPKNFV
VINQKGIDPMSLDVLKNGILALRRAKRRNMERLQFACGGVAQNSVEDLTPDVLGWAGLVY
EHTLGEEKYTFVEDVKEPKSVTMIKGPNAHTMTQIQDALRDGFRSIKNAIEDNSVIPGAG
AFELACSAHLNSSLKTLAKGRAKLGVQAFAEALVIPKTLAANGGYDVQDAIVGLQQELEE
AGEDGVVGLDLKSGEPMDPVVEGVWDNYRVKRQMLHGAAIAVNLLNVDEVLRAGRSSLKE
GPGP
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...