cpnDB: A Chaperonin Database
October 23, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19685 - LAST ADDITION: 2014-09-21

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b7440
Chaperonin Group: I
Deposit Date: 2005-02-07
Type: ref
Type strain?: no
Genus: Wolbachia
Species: sp.
Strain: -
Lineage: root; cellular organisms; Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Rickettsiaceae; Wolbachieae; Wolbachia
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AAGB01000050
Nucleotide Genbank gi: 58534646
Peptide Genbank Accession: EAL58775
Peptide Genbank gi: 58534651
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Host is Drosophila ananassae. From whole genome shotgun sequence.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGACTAATGTAGTAGTATCAGGTGAGCAGTTGCAAGAAGCCTTTCGTGAAGTCGCAGCA
ATAGTAGACTCAACGGTGGCAATAACTGCGGGACCTAGAGGAAAAACAGTAGGGATTAAT
AAGCCCTATGGAGCACCAGAAATTACAAAAGATGGTTATAAGGTGATGAAGGGTATCAAG
CCTGAAAAACCATTAAACGCTGCGATAGCAAGCATCTTTGCACAAAGTTGTTCTCAATGT
AACGATAAAGTTGGTGATGGTACAACAACGTGCTCAATACTAACTAGCAACATGATAATG
GAAGCTTCAAAATCAATTGCTGCTGGAAACGATCGTGTTGGTATTAAAAACGGAATACAG
AAGGCAAAAGATGTAATATTAAAGGAAATTGCGTCAATGTCTCGTACAATTTCTCTAGAG
AAAATAGACGAAGTGGCACAAGTTGCAATAATCTCTGCAAATGGTGATAAGGATATAGGT
AACAGTATCGCTGATTCCGTGAAAAAAGTTGGAAAAGAGGGTGTAATAACTGTTGAAGAG
AGTAAAGGTTCAAAAGAGTTAGAAGTTGAGCTGACTACTGGCATGCAATTTGATCGCGGT
TATCTCTCTCCGTATTTTATTACAAATAATGAAAAAATGATCGTGGAGCTTGATAATCCT
TATCTATTAATTACAGAGAAAAAATTAAATATTATTCAACCTTTACTTCCTGTTCTTGAA
GCTATTGTTAAATCTGGTAAACCTTTGGTTATTATTGCAGAGGATATCGAAGGTGAAGCA
TTAAGCACTTTAGTTATCAATAAATTGCGTGGTGGTTTAAAAGTTGCTGCAGTAAAAGCT
CCAGGTTTTGGTGACAGAAGAAAGGAGATGCTCGAAGACATAGCAACTTTGACTGGTGCT
AAGTACGTCATAAAAGATGAACTTGGAATCAAGATGGAAGATCTCACGCTTGATGATCTT
GGTACGGCTAAAAATGTTAAAATTACTAAAGATAATACCACAGTTGTCAGCGAAAATAGC
GATTCTGACAGTGTGAAAGCTAGAATCGAGCAGATTAAATCTCAAATTGAAACTTCAACT
TCTGATTATGATAAAGAAAAGCTAAGAGAACGTTTAGCGAAATTATCAGGTGGCGTTGCT
GTGCTCAAAGTTGGTGGAGCAACTGAAGTGGAAGTTAAAGAACGTAGAGATAGAGTCGAA
GATGCGCTGCATGCAACAAGAGCTGCAATTGAAGAAGGTATAGTTCCAGGTGGTGGGGTT
GCGCTTCTTTATGCTTCATCTGTTCTCGACAAATTAAAAGGTGCAAGTGACGAGGAACAA
ATAGGCATAAACATTATCAAGAAAGTTCTCAGTGCTCCAATTAGAAGGTTAGTTAAAAAT
GCTGGTCTTGAATCTGCTGTTATAATTGACTATTTGATTAAGCAGAATGATAAAGAGCTT
ATATACAACGTTGAGGCTATGAATTACGCTAATGCATTTACAGCTGGTGTGATTGATCCA
GCAAAAGTGGTGCGTATTGCTTTTGAAACAGCGGTATCTGTTGCGAGTGTGCTGATAACT
ACTGAATCTATGATAGTTGATGTACCAAGCAAAGAAAATGCTTCATCTCCTATGGGTGCA
GGAGAAATGAGTGGCATGGGTGGATTCTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MTNVVVSGEQLQEAFREVAAIVDSTVAITAGPRGKTVGINKPYGAPEITKDGYKVMKGIK
PEKPLNAAIASIFAQSCSQCNDKVGDGTTTCSILTSNMIMEASKSIAAGNDRVGIKNGIQ
KAKDVILKEIASMSRTISLEKIDEVAQVAIISANGDKDIGNSIADSVKKVGKEGVITVEE
SKGSKELEVELTTGMQFDRGYLSPYFITNNEKMIVELDNPYLLITEKKLNIIQPLLPVLE
AIVKSGKPLVIIAEDIEGEALSTLVINKLRGGLKVAAVKAPGFGDRRKEMLEDIATLTGA
KYVIKDELGIKMEDLTLDDLGTAKNVKITKDNTTVVSENSDSDSVKARIEQIKSQIETST
SDYDKEKLRERLAKLSGGVAVLKVGGATEVEVKERRDRVEDALHATRAAIEEGIVPGGGV
ALLYASSVLDKLKGASDEEQIGINIIKKVLSAPIRRLVKNAGLESAVIIDYLIKQNDKEL
IYNVEAMNYANAFTAGVIDPAKVVRIAFETAVSVASVLITTESMIVDVPSKENASSPMGA
GEMSGMGGF
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
TGCTCAATACTAACTAGCAACATGATAATGGAAGCTTCAAAATCAATTGCTGCTGGAAAC
GATCGTGTTGGTATTAAAAACGGAATACAGAAGGCAAAAGATGTAATATTAAAGGAAATT
GCGTCAATGTCTCGTACAATTTCTCTAGAGAAAATAGACGAAGTGGCACAAGTTGCAATA
ATCTCTGCAAATGGTGATAAGGATATAGGTAACAGTATCGCTGATTCCGTGAAAAAAGTT
GGAAAAGAGGGTGTAATAACTGTTGAAGAGAGTAAAGGTTCAAAAGAGTTAGAAGTTGAG
CTGACTACTGGCATGCAATTTGATCGCGGTTATCTCTCTCCGTATTTTATTACAAATAAT
GAAAAAATGATCGTGGAGCTTGATAATCCTTATCTATTAATTACAGAGAAAAAATTAAAT
ATTATTCAACCTTTACTTCCTGTTCTTGAAGCTATTGTTAAATCTGGTAAACCTTTGGTT
ATTATTGCAGAGGATATCGAAGGTGAAGCATTAAGCACTTTAGTTATCAATAAATTGCGT
GGTGGTTTAAAAGTTGCTGCAGTA
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
CSILTSNMIMEASKSIAAGNDRVGIKNGIQKAKDVILKEIASMSRTISLEKIDEVAQVAI
ISANGDKDIGNSIADSVKKVGKEGVITVEESKGSKELEVELTTGMQFDRGYLSPYFITNN
EKMIVELDNPYLLITEKKLNIIQPLLPVLEAIVKSGKPLVIIAEDIEGEALSTLVINKLR
GGLKVAAV
Comments or questions...