cpnDB: A Chaperonin Database
September 30, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19685 - LAST ADDITION: 2014-09-21

RECORD DETAILS

For gi 68352484, see also: b7588

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b7589
Chaperonin Group: II
Deposit Date: 2005-07-05
Type: ref
Type strain?: no
Genus: Theileria
Species: parva
Strain: strain Muguga
Lineage: root; cellular organisms; Eukaryota; Alveolata; Apicomplexa; Aconoidasida; Piroplasmida; Theileriidae; Theileria
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AAGK01000001
Nucleotide Genbank gi: 68352484
Peptide Genbank Accession: EAN34351
Peptide Genbank gi: 68353591
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Bovine pathogen. Chromosome I.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGTTTCAACACAAGTTTGGAGCCAGGGCTCTCATGAGAGAGGGCGGAAAGTTTTTGGGA
GCCGCAGATAACCCAACTCTACGTAACATAGAAGCAATACAGCAAATCTCTGACATGTTG
AAGACGTCGTTGGGACCTAATAGCATGAAGAAACTCATTGTGAACCATATCGACAAAAAA
TTCGTAACGTCGGATTGCAACACCATTTTAGCTGAATTGGAAGTAGTACACCCAGTGGGC
AAGATAGTCTTAAGTTCAGTAGAGTCACAAAAGCTCCAGTTTGGCGATGGAACAAATACC
CTGGTGGCTCTTTTGGGAGATCTCTTAACAAACGCAGGCGAATTGCTACAAGACGGAGTA
CACATTTCAGATATCAGAAAAGGGTACGAAATAGCATTCAACAAACTGATGGAACATCTA
CCAAGTTTGGTTTGTTATAATATCAAGGATTTGAGGGACCATGAAAGTTTGAGAGGAGTA
CTGTATAGCGCAATGAACTCAAAGTTCAGCTATATGTCGGAATTCTTGAGCAAACTAGTT
ACGGACGCAGTGATATCAGTGATGCCAGCAGACGTATCAACGTTCGATCCTCAAAATGTC
AGAGTAGTTAAGCTTACAGGAGGCTCACTCATGGAATCCAATGTAGTCAATGGGCTCGTG
CTAATTAGAGAACCTTTAGGGTCAGTAAAGAAGGCATACAACTGCAGAGTTCTAGTGCTA
TCAGTAGGTTTGGAGTTTGCAGGACCTGAAACGAAAGGAACCGTATTGTTGAAAACAGCT
GAGCAGCTGTTGAACTTCACCAAGGGAGAAGAGAAGGAAATGGAAACAGTAATCAAGTCA
ATAAGTGACAAGGGAGTGGGAGTTATTGTATGTAACGGAGCAGTCTCAGAAATGGCACTC
CACTTCTGCAACAAATACAATATTCTTGTGCTGAAATTAATCTCTAAATTTGATCTAAGG
AGAGTGTGTAGAACCACAAGGTCACAAGCTGTGATGAACCTTTCACAACTCTTACCGCAG
AAAACTGATGTCCAAAATGGAGCAACCGCTGATGTAAATGAGGAACTTGGATATGTGGAG
AGTGTGGAACTAACTGAAATTAGCAGTAAGAAGTGCGTTATAATGAAGGCTAAGGACTCC
AGAGTCAACACTATTGTACTAAAGGGAGCAACAAACAACCAATTAGACGAAGTAGAAAGA
GGAATCGATGACGCAGTTGCATTAGTGGATAATTTAAAAGTTGATGGTAAATTTTTACCG
GGAGCCGGGGCAGTAGAATTACAACTATCTGTACTACTTAAGAAGTTCAGCACCTCAGTA
TCAGGTTTGGAAAGATACGCAGTTGAAGCCTTCGCAAAATCTCTACAAGTTGTTCCTAAA
ATATTAGCAACTAACGCAGGAGTTGATTGCGAAACACTCCTAACAAACCTTCTAAGCCTC
CATGAGAATGGAAAGAACAATTCATGTGTAGATGTTGAAACAGGAAGCTGCGGGGATTCC
ATGGAATTGAAGGTTTTTGATCACTATCAGACGAAACATAATTTATTAACACTGTGTTAC
GAAGCACTGATGACTATACTAACAGTGGACCAGATCATAGTAGCAAAACCAGCAGGAGGC
CCAAAACCGCCAAGTCAAAATAACCCAGATTTCTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MFQHKFGARALMREGGKFLGAADNPTLRNIEAIQQISDMLKTSLGPNSMKKLIVNHIDKK
FVTSDCNTILAELEVVHPVGKIVLSSVESQKLQFGDGTNTLVALLGDLLTNAGELLQDGV
HISDIRKGYEIAFNKLMEHLPSLVCYNIKDLRDHESLRGVLYSAMNSKFSYMSEFLSKLV
TDAVISVMPADVSTFDPQNVRVVKLTGGSLMESNVVNGLVLIREPLGSVKKAYNCRVLVL
SVGLEFAGPETKGTVLLKTAEQLLNFTKGEEKEMETVIKSISDKGVGVIVCNGAVSEMAL
HFCNKYNILVLKLISKFDLRRVCRTTRSQAVMNLSQLLPQKTDVQNGATADVNEELGYVE
SVELTEISSKKCVIMKAKDSRVNTIVLKGATNNQLDEVERGIDDAVALVDNLKVDGKFLP
GAGAVELQLSVLLKKFSTSVSGLERYAVEAFAKSLQVVPKILATNAGVDCETLLTNLLSL
HENGKNNSCVDVETGSCGDSMELKVFDHYQTKHNLLTLCYEALMTILTVDQIIVAKPAGG
PKPPSQNNPDF
Nucleotide UT Sequence: -
Peptide UT Sequence: -
Comments or questions...