cpnDB: A Chaperonin Database
April 20, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19501 - LAST ADDITION: 2014-04-18

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b7643
Chaperonin Group: I
Deposit Date: 2005-08-01
Type: ref
Type strain?: no
Genus: Xylella
Species: fastidiosa
Strain: Dixon
Lineage: root; cellular organisms; Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Xylella
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AAAL02000001
Nucleotide Genbank gi: 71164151
Peptide Genbank Accession: EAO13985
Peptide Genbank gi: 71164271
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Isolate from almond (leaf scorch).
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCTGCCAAAGAAATTATTTTCAGTGAAAAAGCCCGTTCACGTATGGTGTACGGGGTG
AACCTACTTGCTAATGCAGTAAAAGCCACCTTAGGTCCCAAAGGCCGCAACGTGGTGCTT
GATAAGAACTTCGGCTCCCCAATCATTACTAAAGACGGCGTCTCTGTCGCCAAAGAAATT
GAGCTGGCCGACAAGTTTGAAAACATGGGCGCACAAATGCTTAAAGAAGTTGCGTCCAAA
ACAAATGACCATGCAGGCGACGGCACCACCACTGCCACGGTACTAGCCCAGGCGTTGATC
CGTGAAGGATGCAAAGCAGTGGCCGCTGGTATGAATCCAATGGATCTTAAGCGTGGTATC
GATAAAGCAGTCATTGCCGCAGTTACCGAACTGAAGAAGATCTCCAAGCCAACCAGCGAC
GATAAAGCAATTGCCCAAGTCGCAACGATCTCTGCTAACTCAGACGAGTCTATCGGCAAC
ATTATTGCCGAAGCAATGAAGAAGGTCGGTAAAGAAGGAGTGATTACCATTGAGGAAGGC
ACAACTCTAGAAAACGAATTGGATGTCGTCGAAGGGATGCAGTTTGACCGTGGTTACTCT
TCGCCATATTTCATCAACAACCAGCAGTCCCAAATTGTTGAGCTGGATAATCCCTACATC
CTCCTTCACGACAAGAAAATTTCCAATGTGCGCGATTTACTCACCGTGCTTGACGCCGTC
GCCAAAGAAAGCAAGCAGTTGCTGATCGTCGCTGAGGAAGTCGAAGGCGAAGCTTTGGCA
ACTCTGGTCGTTAACAACATCCGCGGCATCATCAAAGTTTGCGCAGTCAAAGCACCTGGC
TTCGGTGATCGTCGCAAAGCCATGCTGGAAGATATGGCTGTGCTGACAGGCGGCACCGTC
ATCTCGGAAGAAGTAGGTCTGTCTCTGGAAAAGGCCACGACCAGCCACCTTGGCAAGGCC
AAGAAAGTACGCGTCTCTAAAGAAAACACCACCATTATTGATGGTATGGGTGACAACGAT
GCGATCAATGGTCGCGTCAAGCAAATCAAAACCCAGATCGAGGAAACCACCTCGGACTAC
GACCGCGAAAAACTGCAGGAACGTGTAGCCAAGCTCGCCGGTGGTGTAGCCGTCATCAAG
GTCGGTGCTGCAACCGAAGTGGAAATGAAGGAAAAGAAAGCACGTGTTGATGATGCTTTA
CTTGCAACGCGTGCAGCCGTTGAAGAAGGAGTAATTCCAGGCGGCGGCGTGGCCCTGATA
CGTGTAATCACAGCAATCAGCAATCTGAAGGGTGCCAATGAAGACCAGACACACGGCATT
CAAATCGCATTGCGGGCTATGGAAGCACCATTACGCGAAATTGTTGCCAACGCCGGTGAA
GAGCCATCGGTCATCTTAAATAAGGTGAAAGAAGGCAAGGGCAATTTTGGCTACAACGCC
GCTACTGGCGAATTCGGCGATATGGTCAATTTTGGCATCCTGGACCCAACCAAGGTCACA
CGTTCAGCACTGCAGAACGCTGCTTCAATCGCTGGCCTGATGATCACCACAGAAGCAATG
ATCGCCGAGGCTCCGAAGAAGGACGAGCCAACCCCACCTGCTGCTGGCGGCGGTATGGGC
GGTATGGGCGGTATGGATTTCTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAAKEIIFSEKARSRMVYGVNLLANAVKATLGPKGRNVVLDKNFGSPIITKDGVSVAKEI
ELADKFENMGAQMLKEVASKTNDHAGDGTTTATVLAQALIREGCKAVAAGMNPMDLKRGI
DKAVIAAVTELKKISKPTSDDKAIAQVATISANSDESIGNIIAEAMKKVGKEGVITIEEG
TTLENELDVVEGMQFDRGYSSPYFINNQQSQIVELDNPYILLHDKKISNVRDLLTVLDAV
AKESKQLLIVAEEVEGEALATLVVNNIRGIIKVCAVKAPGFGDRRKAMLEDMAVLTGGTV
ISEEVGLSLEKATTSHLGKAKKVRVSKENTTIIDGMGDNDAINGRVKQIKTQIEETTSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDALLATRAAVEEGVIPGGGVALI
RVITAISNLKGANEDQTHGIQIALRAMEAPLREIVANAGEEPSVILNKVKEGKGNFGYNA
ATGEFGDMVNFGILDPTKVTRSALQNAASIAGLMITTEAMIAEAPKKDEPTPPAAGGGMG
GMGGMDF
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCCACGGTACTAGCCCAGGCGTTGATCCGTGAAGGATGCAAAGCAGTGGCCGCTGGTATG
AATCCAATGGATCTTAAGCGTGGTATCGATAAAGCAGTCATTGCCGCAGTTACCGAACTG
AAGAAGATCTCCAAGCCAACCAGCGACGATAAAGCAATTGCCCAAGTCGCAACGATCTCT
GCTAACTCAGACGAGTCTATCGGCAACATTATTGCCGAAGCAATGAAGAAGGTCGGTAAA
GAAGGAGTGATTACCATTGAGGAAGGCACAACTCTAGAAAACGAATTGGATGTCGTCGAA
GGGATGCAGTTTGACCGTGGTTACTCTTCGCCATATTTCATCAACAACCAGCAGTCCCAA
ATTGTTGAGCTGGATAATCCCTACATCCTCCTTCACGACAAGAAAATTTCCAATGTGCGC
GATTTACTCACCGTGCTTGACGCCGTCGCCAAAGAAAGCAAGCAGTTGCTGATCGTCGCT
GAGGAAGTCGAAGGCGAAGCTTTGGCAACTCTGGTCGTTAACAACATCCGCGGCATCATC
AAAGTTTGCGCAGTC
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAQALIREGCKAVAAGMNPMDLKRGIDKAVIAAVTELKKISKPTSDDKAIAQVATIS
ANSDESIGNIIAEAMKKVGKEGVITIEEGTTLENELDVVEGMQFDRGYSSPYFINNQQSQ
IVELDNPYILLHDKKISNVRDLLTVLDAVAKESKQLLIVAEEVEGEALATLVVNNIRGII
KVCAV
Comments or questions...