cpnDB: A Chaperonin Database
November 26, 2014 - LOGGED IN AS: guest - SEARCHABLE RECORDS: 19710 - LAST ADDITION: 2014-11-02

RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b7803
Chaperonin Group: I
Deposit Date: 2005-11-28
Type: ref
Type strain?: no
Genus: Staphylococcus
Species: aureus
Strain: RF122
Lineage: root; cellular organisms; Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AJ938182
Nucleotide Genbank gi: 82655308
Peptide Genbank Accession: CAI81602
Peptide Genbank gi: 82657162
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Bovine mastitis asociated strain.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGTTAAACAATTGAAATTCTCTGAAGATGCACGTCAAGCAATGTTACGTGGTGTTGAC
CAATTAGCAAATGCAGTTAAAGTAACGATTGGTCCTAAAGGACGTAATGTTGTATTAGAT
AAAGAGTTTACAGCACCTTTAATTACGAACGATGGTGTAACGATTGCTAAAGAAATCGAA
TTAGAAGATCCATATGAAAATATGGGGGCTAAACTAGTTCAAGAAGTCGCAAATAAGACA
AATGAAATTGCTGGTGACGGTACGACAACTGCAACAGTGTTAGCTCAAGCAATGATTCAA
GAAGGCTTGAAAAATGTTACAAGCGGTGCGAACCCAGTCGGTTTACGACAGGGTATCGAT
AAAGCAGTTAAAGTTGCTGTTGAAGCGTTACATGAAAATTCTCAAAAAGTTGAAAATAAA
AATGAAATTGCGCAAGTAGGTGCGATTTCTGCAGCAGATGAAGAAATTGGGCGTTATATT
TCTGAAGCTATGGAAAAAGTAGGCAATGATGGTGTCATTACAATTGAAGAATCAAATGGC
TTGAACACTGAACTTGAAGTGGTTGAAGGTATGCAATTTGATCGTGGTTATCAATCACCG
TATATGGTTACTGATTCAGATAAAATGGTTGCTGAATTAGAACGCCCATACATTTTAGTG
ACAGATAAGAAAATCTCATCATTCCAAGATATCTTACCTTTACTAGAACAAGTGGTTCAA
TCTAATCGTCCAATCTTAATTGTAGCTGATGAAGTCGAAGGCGATGCATTAACAAATATC
GTGCTAAACCGTATGCGTGGCACATTTACAGCTGTTGCAGTAAAAGCACCTGGTTTCGGT
GATCGTCGTAAAGCAATGTTAGAAGATTTAGCTATTTTAACTGGTGCGCAAGTGATTACT
GATGATTTAGGTCTAGATTTAAAAGATGCATCAATAGATATGTTAGGTACTGCAAGTAAA
GTAGAAGTAACTAAAGATAATACAACTGTTGTTGATGGTGACGGTGACGAAAACAGCATT
GATGCACGTGTAAGCCAATTGAAATCTCAAATTGAAGAAACTGAATCTGACTTTGATCGT
GAAAAATTACAAGAGCGCTTAGCTAAATTAGCAGGTGGTGTTGCAGTTATCAAGGTAGGT
GCAGCAAGTGAAACAGAACTTAAAGAACGTAAATTACGCATTGAAGATGCATTAAATTCT
ACACGTGCAGCAGTTGAAGAAGGTATTGTTGCAGGTGGTGGTACTGCACTAGTAAATGTT
TACCAAAAAGTAAGTGAAATTGAAGCTGAAGGCGACATTGAAACAGGTGTGAATATTGTA
CTTAAAGCATTAACTGCACCAGTTCGCCAAATTGCTGAAAATGCAGGATTAGAAGGTTCT
GTTATTGTAGAACGTTTGAAAAACGCAGAGCCGGGTGTTGGTTTTAACGCTGCTACAGAC
GAGTGGGTTAATATGTTAGAAGCAGGTATCGTTGATCCAACTAAAGTAACACGCTCAGCA
TTACAACATGCAGCAAGTGTTGCGGCAATGTTCTTAACTACTGAAGCGGTTGTGGCATCA
ATTCCTGAAAAAAATAATGACCAACCTAACATGGGTGGCATGCCAGGAATGATGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MVKQLKFSEDARQAMLRGVDQLANAVKVTIGPKGRNVVLDKEFTAPLITNDGVTIAKEIE
LEDPYENMGAKLVQEVANKTNEIAGDGTTTATVLAQAMIQEGLKNVTSGANPVGLRQGID
KAVKVAVEALHENSQKVENKNEIAQVGAISAADEEIGRYISEAMEKVGNDGVITIEESNG
LNTELEVVEGMQFDRGYQSPYMVTDSDKMVAELERPYILVTDKKISSFQDILPLLEQVVQ
SNRPILIVADEVEGDALTNIVLNRMRGTFTAVAVKAPGFGDRRKAMLEDLAILTGAQVIT
DDLGLDLKDASIDMLGTASKVEVTKDNTTVVDGDGDENSIDARVSQLKSQIEETESDFDR
EKLQERLAKLAGGVAVIKVGAASETELKERKLRIEDALNSTRAAVEEGIVAGGGTALVNV
YQKVSEIEAEGDIETGVNIVLKALTAPVRQIAENAGLEGSVIVERLKNAEPGVGFNAATD
EWVNMLEAGIVDPTKVTRSALQHAASVAAMFLTTEAVVASIPEKNNDQPNMGGMPGMM
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCAACAGTGTTAGCTCAAGCAATGATTCAAGAAGGCTTGAAAAATGTTACAAGCGGTGCG
AACCCAGTCGGTTTACGACAGGGTATCGATAAAGCAGTTAAAGTTGCTGTTGAAGCGTTA
CATGAAAATTCTCAAAAAGTTGAAAATAAAAATGAAATTGCGCAAGTAGGTGCGATTTCT
GCAGCAGATGAAGAAATTGGGCGTTATATTTCTGAAGCTATGGAAAAAGTAGGCAATGAT
GGTGTCATTACAATTGAAGAATCAAATGGCTTGAACACTGAACTTGAAGTGGTTGAAGGT
ATGCAATTTGATCGTGGTTATCAATCACCGTATATGGTTACTGATTCAGATAAAATGGTT
GCTGAATTAGAACGCCCATACATTTTAGTGACAGATAAGAAAATCTCATCATTCCAAGAT
ATCTTACCTTTACTAGAACAAGTGGTTCAATCTAATCGTCCAATCTTAATTGTAGCTGAT
GAAGTCGAAGGCGATGCATTAACAAATATCGTGCTAAACCGTATGCGTGGCACATTTACA
GCTGTTGCAGTA
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAQAMIQEGLKNVTSGANPVGLRQGIDKAVKVAVEALHENSQKVENKNEIAQVGAIS
AADEEIGRYISEAMEKVGNDGVITIEESNGLNTELEVVEGMQFDRGYQSPYMVTDSDKMV
AELERPYILVTDKKISSFQDILPLLEQVVQSNRPILIVADEVEGDALTNIVLNRMRGTFT
AVAV
Comments or questions...