RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b11998
Chaperonin Group: I
Deposit Date: 2008-04-27
Type: ref
Type strain?: no
Genus: Cyanothece
Species: sp.
Strain: PCC 7424
Lineage: root; cellular organisms; Bacteria; Cyanobacteria; Chroococcales; Cyanothece
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: NC_011729
Peptide Genbank Accession: YP_002378122
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: This strain was isolated from a rice field in Senegal.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCCAAAATCGTTTCTTTCAAAGATGAATCTAGAAGAGCCTTAGAAAGGGGAATTAAC
GCCCTTGCTGATGCGGTTAAGATTACCCTAGGCCCAAGAGGGCGCAATGTTCTACTAGAA
AAGAAATTCGGCGCACCCCAAATTGTTAATGATGGGATCACCGTTGCCAAAGAAATTGAC
TTAGAAGATCCCCTAGAAAATACCGGGGCAAAACTGATCCAAGAAGTAGCATCTAAAACC
AAAGATGTAGCCGGAGATGGCACAACTACTGCTACCGTTATCGCTCAAGCCCTGATTAAA
GAAGGGTTAAGAAACGTTACCGCCGGGGCTAACCCCGTGGCCTTACGTCGTGGATTAGAA
AAAATTACTAATTTCTTGGTTCAAGAAATTGAAAGCGTTGCTAAACCTGTCGAAATGGGA
GAAGCGATCGCCCAAGTGGCTACCGTATCCGCCGGTAATGATGAAGAAGTCGGTCAGATG
ATCGCTTTAGCGATGGAAAAAGTGACCAAAGATGGAGTCATTACTGTTGAGGAGTCTAAG
TCTCTGTCTACAGAATTAGATGTCGTTGAAGGGATGCAACTCGATCGCGGTTATATCTCT
CCTTACTTTATTACGGATCAGGAACGCCAAATCACCGACTTCGATAATCCTTATATTCTG
ATCACCGATAAGAAAATTAGCGCGATCGCTGATTTAGTTCCTGTGCTGGAAACCGTAGCC
CGTCAAGGCCGGGCGCTGTTAATTGTGGCGGAGGATGTAGAAGGAGAAGCCCTTGCTACC
CTAGTCGTAAATAAGGCACGAGGAGTCTTAAATGTTGCGGCAATTAAAGCCCCGAGTTTT
GGGGAACGACGCAAAGCCGCCTTACAAGATATCGCTATCCTCACCGGTGGGCGTGTTATT
TCTGAAGAAATTGGCCTCAGTTTAGAAACCGTTACCCCCGATATGTTAGGTCAAGCGGTT
AAAGTGACCGTTGATAAAGAAAATACCACCATCGTCGCGGGAGGAGATCATAAGGCGGAT
GTCCAAAAACGCATTGTCCAACTCCGCAAAGAATTAGAAGCGACTGACTCGGAATATGAC
ACCGAAAAACTCCAAGAACGCATTGCTAAATTAGCGGGAGGAGTCGCGGTGATTAAAGTT
GGGGCGGCTACGGAAACTGAACTGAAAGACAAAAAACTCCGCATTGAAGATGCTCTTAAT
GCTACTAAAGCGGCGGTAGCTGAGGGAATTGTTCCCGGTGGAGGCACTACGTTAATTCAT
CTGGCGGCTAAGGTTGTAGACTTTAAAAATACCTTAAGCAATGATGAGGAAAAAGTCGCT
GCTGACATCATGGCTAAAGCTTTAGAAGCCCCTTTACGTCAATTAGCAGATAATGCAGGA
TTAGAAGGGTCTGTTATTGTGGAAGGAGTACGCAATACCGACTTTAACGTGGGATACAAT
GCGTTAACCGGTGAGTTTGAGGACTTGATCAAGGCGGGTATCATTGACCCGGCTAAAGTC
GTCCGTTCTGCGCTGCAAAATGCCTCTTCTATTGCAGGGATGGTACTCACCACCGAAGCC
TTAGTTGTTGAGAAGCCCGAAAAGCAAGCTCCCGCACCTGATATGGGCGGCATGGGCGGC
ATGGGCGGCATGGGTGGCATGGGCGGCATGGGCGGCATGGGCATGATGTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAKIVSFKDESRRALERGINALADAVKITLGPRGRNVLLEKKFGAPQIVNDGITVAKEID
LEDPLENTGAKLIQEVASKTKDVAGDGTTTATVIAQALIKEGLRNVTAGANPVALRRGLE
KITNFLVQEIESVAKPVEMGEAIAQVATVSAGNDEEVGQMIALAMEKVTKDGVITVEESK
SLSTELDVVEGMQLDRGYISPYFITDQERQITDFDNPYILITDKKISAIADLVPVLETVA
RQGRALLIVAEDVEGEALATLVVNKARGVLNVAAIKAPSFGERRKAALQDIAILTGGRVI
SEEIGLSLETVTPDMLGQAVKVTVDKENTTIVAGGDHKADVQKRIVQLRKELEATDSEYD
TEKLQERIAKLAGGVAVIKVGAATETELKDKKLRIEDALNATKAAVAEGIVPGGGTTLIH
LAAKVVDFKNTLSNDEEKVAADIMAKALEAPLRQLADNAGLEGSVIVEGVRNTDFNVGYN
ALTGEFEDLIKAGIIDPAKVVRSALQNASSIAGMVLTTEALVVEKPEKQAPAPDMGGMGG
MGGMGGMGGMGGMGMM
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCTACCGTTATCGCTCAAGCCCTGATTAAAGAAGGGTTAAGAAACGTTACCGCCGGGGCT
AACCCCGTGGCCTTACGTCGTGGATTAGAAAAAATTACTAATTTCTTGGTTCAAGAAATT
GAAAGCGTTGCTAAACCTGTCGAAATGGGAGAAGCGATCGCCCAAGTGGCTACCGTATCC
GCCGGTAATGATGAAGAAGTCGGTCAGATGATCGCTTTAGCGATGGAAAAAGTGACCAAA
GATGGAGTCATTACTGTTGAGGAGTCTAAGTCTCTGTCTACAGAATTAGATGTCGTTGAA
GGGATGCAACTCGATCGCGGTTATATCTCTCCTTACTTTATTACGGATCAGGAACGCCAA
ATCACCGACTTCGATAATCCTTATATTCTGATCACCGATAAGAAAATTAGCGCGATCGCT
GATTTAGTTCCTGTGCTGGAAACCGTAGCCCGTCAAGGCCGGGCGCTGTTAATTGTGGCG
GAGGATGTAGAAGGAGAAGCCCTTGCTACCCTAGTCGTAAATAAGGCACGAGGAGTCTTA
AATGTTGCGGCAATT
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVIAQALIKEGLRNVTAGANPVALRRGLEKITNFLVQEIESVAKPVEMGEAIAQVATVS
AGNDEEVGQMIALAMEKVTKDGVITVEESKSLSTELDVVEGMQLDRGYISPYFITDQERQ
ITDFDNPYILITDKKISAIADLVPVLETVARQGRALLIVAEDVEGEALATLVVNKARGVL
NVAAI