Chaperonin ID: b12498
Chaperonin Group: I
Deposit Date: 2008-08-17
Type: fie
Type strain?: no
Genus: Cyanothece
Species: sp.
Strain: PCC 7822
Lineage: root; cellular organisms; Bacteria; Cyanobacteria; Chroococcales; Cyanothece
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: NC_014501
Peptide Genbank Accession: YP_003885718
Best FASTA Match: b11999 Cyanothece sp. PCC 7424 (see fasta results)
Date of FASTA search: 2020-09-21
FASTA identity %: 90.100
Best BLASTP Match: b11999 Cyanothece sp. PCC 7424 (see blastp results)
Date of BLASTP search: 2020-09-21
BLASTP identity %: 97.838
Source: Genbank
Notes: Cyanothece sp. PCC 7822 was isolated from rice fields in Cuttack, Orissa, India
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCTAAATCTATCATTTACAACGACGAAGCACGCCGCGCACTAGAACGAGGAATGGAT
ATCCTCGCTGAATCTGTAGCCGTTACTCTCGGTCCAAAAGGACGTAACGTAGTATTAGAA
AAGAAATTTGGTGCCCCGCAGATTGTTAACGACGGGATCACCATTGCTAAAGAAATTGAA
TTAGAAGATCACATTGAGAATACCGGCGTTTCTTTAATTCGTCAAGCCGCTTCTAAAACC
AATGATGTCGCTGGAGACGGGACCACCACCGCTACCGTACTCGCTCACGCAATGGTTAAA
GAAGGGTTACGCAACGTTGCTGCTGGTGCTAACCCCATTTCTATCAAGCGTGGGATCGAC
AAAGCGACCGAGTATTTAGTCGGCAAGATTGCAGAACACGCTAAACCGGTTGAAGACTCC
AAAGCGATCTCTCAAGTGGGTGCCATCTCTGCGGGTAACGATGAAGAAGTCGGCAGCATG
ATCGCTCAAGCGATGGATAAAGTCGGTAAGGAAGGGGTTATCTCCCTCGAAGAAGGGAAG
TCCATGACGACCGAACTCGAAATTACCGAAGGGATGCGCTTTGATAAGGGTTATATCTCT
CCCTACTTCGTGACTGATACAGAGCGCATGGAGTGCGTTTTCGATGACCCCGCCATCCTG
CTCACCGATAAGAAAATCGCGCTAGTACAAGATTTAGTGCCTGTATTAGAACAGGTTGCT
CGTGCTGGCAAACCGTTATTAATTCTCGCTGAAGATATCGAAAAAGAAGCGCTTGCTACT
CTAGTCGTTAACCGTCTGCGCGGTGTATTAAATGTCGCTGCGGTTAAAGCACCGGGTTTT
GGCGATCGCCGTAAGCAAATGCTCGAAGATATCGCGGTTCTGACTGGTGGTCAAGTGATC
AGCGAAGATGCTGGACTCAAGCTAGAAAATACCAAGCTTGATATGCTCGGTAAAGCTCGC
CGTATTACCATCACCAAAGATAACACCACCATTGTTGCTGAAGGTAACGAAGCGGGTGTT
AAAGCGCGTTGCGAACAAATTCGCCGTCAAATCGAAGAAACCGAGTCTTCTTACGACAAA
GAAAAATTACAAGAACGTCTTGCTAAGTTATCCGGTGGGGTTGCAGTCATTAAAGTGGGT
GCTGCTACCGAAACCGAAATGAAAGACCGCAAACTCCGCTTAGAAGACGCGATCAACGCA
ACTAAAGCGGCTGTGGAAGAAGGGATCGTTCCTGGTGGCGGTACTACCTTAGCTCATTTA
ACTCCTACCCTCGAAGAGTGGGCAAAAGCTAACCTCAAGACTGAAGAGTTAACCGGTGCG
CTAATTGTTGCTCGTGCGTTAACGGCTCCCTTAAAGCGTATTGCTGAAAATGCCGGACAA
AATGGTGCTGTTGTCGCTGAACGGGTAAAAGAGAAGGAATTCAACGTCGGTTATAATGCC
GCTAATGATACCTTCACCAATATGCTAGAAGCGGGTATCGTTGACCCTGCTAAGGTAACT
CGTTCTGCTCTGCAAAATGCGGCTTCTATTGCAGGTATGGTTCTCACCACTGAGTGTATT
GTGGTTGACAAACCTGAAAAAGAAAAATCTGCTGCGGGTGCTGGCGCTGGCGGCGGTGAT
TTTGATTACTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAKSIIYNDEARRALERGMDILAESVAVTLGPKGRNVVLEKKFGAPQIVNDGITIAKEIE
LEDHIENTGVSLIRQAASKTNDVAGDGTTTATVLAHAMVKEGLRNVAAGANPISIKRGID
KATEYLVGKIAEHAKPVEDSKAISQVGAISAGNDEEVGSMIAQAMDKVGKEGVISLEEGK
SMTTELEITEGMRFDKGYISPYFVTDTERMECVFDDPAILLTDKKIALVQDLVPVLEQVA
RAGKPLLILAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRRKQMLEDIAVLTGGQVI
SEDAGLKLENTKLDMLGKARRITITKDNTTIVAEGNEAGVKARCEQIRRQIEETESSYDK
EKLQERLAKLSGGVAVIKVGAATETEMKDRKLRLEDAINATKAAVEEGIVPGGGTTLAHL
TPTLEEWAKANLKTEELTGALIVARALTAPLKRIAENAGQNGAVVAERVKEKEFNVGYNA
ANDTFTNMLEAGIVDPAKVTRSALQNAASIAGMVLTTECIVVDKPEKEKSAAGAGAGGGD
FDY
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCTACCGTACTCGCTCACGCAATGGTTAAAGAAGGGTTACGCAACGTTGCTGCTGGTGCT
AACCCCATTTCTATCAAGCGTGGGATCGACAAAGCGACCGAGTATTTAGTCGGCAAGATT
GCAGAACACGCTAAACCGGTTGAAGACTCCAAAGCGATCTCTCAAGTGGGTGCCATCTCT
GCGGGTAACGATGAAGAAGTCGGCAGCATGATCGCTCAAGCGATGGATAAAGTCGGTAAG
GAAGGGGTTATCTCCCTCGAAGAAGGGAAGTCCATGACGACCGAACTCGAAATTACCGAA
GGGATGCGCTTTGATAAGGGTTATATCTCTCCCTACTTCGTGACTGATACAGAGCGCATG
GAGTGCGTTTTCGATGACCCCGCCATCCTGCTCACCGATAAGAAAATCGCGCTAGTACAA
GATTTAGTGCCTGTATTAGAACAGGTTGCTCGTGCTGGCAAACCGTTATTAATTCTCGCT
GAAGATATCGAAAAAGAAGCGCTTGCTACTCTAGTCGTTAACCGTCTGCGCGGTGTATTA
AATGTCGCTGCGGTT
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS
AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL
NVAAV