Chaperonin ID: b3672
Chaperonin Group: II
Deposit Date: 2002-12-06
Type: ref
Type strain?: yes
Genus: Methanocaldococcus
Species: jannaschii
Strain: -
Lineage: root; cellular organisms; Archaea; Euryarchaeota; Methanococci; Methanococcales; Methanocaldococcaceae; Methanocaldococcus
Original ID: DSM 2661
CUTC ID: -
Nucleotide Genbank Accession: NC_000909
Peptide Genbank Accession: NP_247993
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: Type strain synonyms DSM 2661 = JAL-1 = ATCC 43067 = CIP 104961 = JCM 10045 = NBRC 100440 = OCM 168.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCAATGGCAGGAGCACCAATAGTAGTATTACCACAAAACGTTAAGAGATACGTTGGA
AGAGATGCTCAAAGAATGAACATCTTAGCAGGTAGAATTATCGCTGAAACAGTTAGAACA
ACATTAGGTCCAAAAGGAATGGACAAAATGTTAGTTGATGAGTTAGGAGACATTGTTGTT
ACAAACGATGGAGTTACAATATTAAAAGAAATGAGTGTTGAGCACCCAGCTGCTAAGATG
TTAATAGAAGTTGCTAAAACCCAAGAAAAAGAAGTTGGAGATGGAACAACAACAGCAGTT
GTTATTGCTGGAGAGTTGTTAAGAAAAGCTGAAGAGTTGTTAGACCAAAACATCCACCCA
TCAGTCATCATCAACGGATACGAAATGGCAAGAAACAAAGCAGTTGAAGAATTAAAGTCA
ATAGCTAAAGAAGTTAAGCCAGAAGACACAGAGATGTTAAAGAAAATTGCAATGACATCA
ATTACTGGTAAAGGAGCAGAGAAAGCAAGAGAACAGTTAGCTGAAATTGTTGTTGAGGCA
GTTAGAGCTGTTGTTGATGAAGAAACTGGAAAAGTTGATAAGGACTTAATTAAAGTTGAG
AAGAAAGAAGGAGCTCCAATTGAAGAAACCAAGTTAATTAGAGGAGTTGTTATTGACAAA
GAGAGAGTCAACCCACAAATGCCAAAGAAAGTTGAAAACGCTAAGATTGCATTATTAAAC
TGCCCAATTGAAGTCAAAGAAACAGAGACAGATGCAGAAATAAGAATTACTGACCCAGCT
AAGTTAATGGAGTTCATTGAGCAAGAAGAGAAGATGATTAAAGACATGGTTGAGAAGATT
GCTGCTACAGGAGCAAATGTAGTATTCTGTCAGAAAGGAATTGATGACTTAGCTCAGCAC
TACTTAGCTAAGAAGGGAATCTTAGCAGTAAGAAGAGTTAAAAAATCAGACATGGAAAAA
TTAGCTAAAGCAACAGGAGCAAGAATCGTTACAAAGATTGACGACTTAACACCAGAGGAC
TTAGGAGAAGCTGGATTAGTTGAAGAGAGAAAAGTTGCTGGAGATGCAATGATATTCGTC
GAGCAGTGCAAGCATCCAAAGGCTGTAACAATCTTAGCAAGAGGTTCAACAGAGCACGTT
GTTGAAGAAGTTGCAAGAGCAATTGATGATGCAATTGGAGTTGTTAAGTGTGCATTAGAA
GAAGGTAAGATTGTTGCTGGTGGGGGAGCAACTGAAATAGAATTAGCTAAGAGATTAAGA
AAATTCGCTGAGTCAGTTGCTGGAAGAGAACAGTTAGCAGTTAAAGCATTCGCTGATGCT
TTAGAAGTCATTCCAAGAACATTAGCTGAAAACTCAGGATTAGACCCAATTGACATGCTC
GTTAAGTTAAGAGCTGCTCACGAGAAAGAAGGCGGAGAAGTCTATGGATTAGATGTCTTC
GAAGGAGAAGTTGTCGATATGTTAGAGAAAGGAGTTGTTGAACCATTGAAAGTTAAAACA
CAAGCTATTGACTCAGCTACAGAGGCATCAGTCATGCTCTTAAGAATCGATGACGTCATA
GCTGCTGAGAAAGTTAAAGGAGACGAAAAAGGAGGAGAAGGAGGAGACATGGGAGGGGAT
GAATTTTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAMAGAPIVVLPQNVKRYVGRDAQRMNILAGRIIAETVRTTLGPKGMDKMLVDELGDIVV
TNDGVTILKEMSVEHPAAKMLIEVAKTQEKEVGDGTTTAVVIAGELLRKAEELLDQNIHP
SVIINGYEMARNKAVEELKSIAKEVKPEDTEMLKKIAMTSITGKGAEKAREQLAEIVVEA
VRAVVDEETGKVDKDLIKVEKKEGAPIEETKLIRGVVIDKERVNPQMPKKVENAKIALLN
CPIEVKETETDAEIRITDPAKLMEFIEQEEKMIKDMVEKIAATGANVVFCQKGIDDLAQH
YLAKKGILAVRRVKKSDMEKLAKATGARIVTKIDDLTPEDLGEAGLVEERKVAGDAMIFV
EQCKHPKAVTILARGSTEHVVEEVARAIDDAIGVVKCALEEGKIVAGGGATEIELAKRLR
KFAESVAGREQLAVKAFADALEVIPRTLAENSGLDPIDMLVKLRAAHEKEGGEVYGLDVF
EGEVVDMLEKGVVEPLKVKTQAIDSATEASVMLLRIDDVIAAEKVKGDEKGGEGGDMGGD
EF
Nucleotide UT Sequence: -
Peptide UT Sequence: -