RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b10697
Chaperonin Group: I
Deposit Date: 2007-12-09
Type: ref
Type strain?: yes
Genus: Bartonella
Species: tribocorum
Strain: CIP 105476
Lineage: root; cellular organisms; Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Bartonellaceae; Bartonella
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AM260525
Peptide Genbank Accession: CAK02276
Best FASTA Match: -
Date of FASTA search: -
FASTA identity %: -
Best BLASTP Match: -
Date of BLASTP search: -
BLASTP identity %: -
Source: Genbank
Notes: From complete genome sequence. Type strain synonyms strain IBS 506 = CCUG 45778 = CIP 105476.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCTGCTAAAGAAGTCAAATTTGGCCGTGAAGCGCGTGAGCGTTTGTTGCGCGGTGTC
GACATCCTTGCTAATGCGGTTAAGGTGACACTCGGCCCTAAAGGGCGCAATGTGGTGATC
GATAAATCATTTGGTGCGCCGCGTATCACAAAAGATGGTGTATCCGTTGCAAAGGAAATC
GAACTGGAAGATAAGTTCGAAAATATGGGTGCGCAGATGTTGCGCGAAGTTGCTTCTAAA
ACCAATGATATTGCTGGGGATGGAACAACAACGGCAACTGTTTTGGGACAAGCTATCGTA
CAAGAAGGTGTCAAAGCCGTTGCTGCGGGCATGAACCCTATGGATCTTAAACGCGGAATT
GATGCTGCTGTGGATGAAGTGGTGGCTAATCTTTTCAAAAAAGCTAAAAAAATCCAAACT
TCTGCAGAAATTGCGCAAGTTGGAACCATTTCGGCCAATGGTGCTGCTGAAATCGGTAAA
ATGATTGCTGATGCCATGGAAAAAGTGGGCAATGAAGGCGTTATTACCGTAGAAGAAGCT
AAAACGGCTGAAACGGAATTGGAAGTCGTGGAAGGAATGCAGTTTGATCGTGGCTATCTT
TCCCCTTACTTCGTCACGAATGCTGAGAAAATGGTTGCAGATCTTGATGATCCTTACATT
CTCATTCACGAAAAGAAACTGTCTAATTTGCAATCCTTGCTTCCCGTTTTGGAAGCCGTT
GTTCAGTCTGGCAAACCCCTTCTTATCATTGCTGAAGATGTGGAAGGTGAAGCTTTGGCA
ACGCTCGTGGTCAACAAATTGCGCGGTGGTTTGAAAATTGCTGCTGTAAAAGCGCCTGGC
TTTGGTGATCGTCGTAAAGCAATGCTTGAAGATATCGCTATCTTGACATCGGGACAGGTG
ATTTCTGAAGATGTCGGCATTAAGCTTGAAAATGTCACTTTGGATATGCTTGGACGTGCA
AAGAAAGTGAATATTTCTAAAGAAAACACCACCATTATTGATGGTGCTGGACAAAAGGCT
GAAATTACCGCACGCGTCAATCAGATTAAAGCGCAGATTGAAGAAACAACTTCTGACTAT
GATCGTGAAAAATTGCAAGAAAGACTTGCTAAACTCGCTGGTGGTGTTGCTGTTATCCGT
GTGGGTGGCGCAACAGAAGTTGAAGTGAAAGAAAAGAAAGACCGTGTGGATGATGCGTTG
AATGCAACACGGGCGGCTGTGGAAGAAGGTATTGTTGCTGGTGGTGGTACTGCATTGTTG
CGTGCAGCAAGTGCGTTGACCGTTAAGGGAGGTAATCCTGACCAAGAAGCTGGTATTAAT
ATCGTTCGTCGTGCTCTCCAGGCTCCAGCACGCCAAATCGCCACCAATGCTGGTGAAGAA
GCAGCGATTATTGTGGGTAAGGTGTTGGAAAATAATGCCGATACATATGGTTACAATACC
GCAACCGGTGAATTTGGTGATTTGATTGCTTTGGGAATTGTTGATCCTGTGAAGGTGGTG
CGTTCTGCGCTTCAGAATGCGGCTTCAATTGCCAGCCTTCTGATCACAACAGAAGCAATG
GTGGCTGAAATGCCAAAGAAAGATACTCCAATGCCTCCAATGCCGGCTGGTGGAATGGGT
GGAATGGGCGGAATGGATTTCTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEI
ELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQEGVKAVAAGMNPMDLKRGI
DAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGKMIADAMEKVGNEGVITVEEA
KTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDPYILIHEKKLSNLQSLLPVLEAV
VQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTSGQV
ISEDVGIKLENVTLDMLGRAKKVNISKENTTIIDGAGQKAEITARVNQIKAQIEETTSDY
DREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALNATRAAVEEGIVAGGGTALL
RAASALTVKGGNPDQEAGINIVRRALQAPARQIATNAGEEAAIIVGKVLENNADTYGYNT
ATGEFGDLIALGIVDPVKVVRSALQNAASIASLLITTEAMVAEMPKKDTPMPPMPAGGMG
GMGGMDF
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCAACTGTTTTGGGACAAGCTATCGTACAAGAAGGTGTCAAAGCCGTTGCTGCGGGCATG
AACCCTATGGATCTTAAACGCGGAATTGATGCTGCTGTGGATGAAGTGGTGGCTAATCTT
TTCAAAAAAGCTAAAAAAATCCAAACTTCTGCAGAAATTGCGCAAGTTGGAACCATTTCG
GCCAATGGTGCTGCTGAAATCGGTAAAATGATTGCTGATGCCATGGAAAAAGTGGGCAAT
GAAGGCGTTATTACCGTAGAAGAAGCTAAAACGGCTGAAACGGAATTGGAAGTCGTGGAA
GGAATGCAGTTTGATCGTGGCTATCTTTCCCCTTACTTCGTCACGAATGCTGAGAAAATG
GTTGCAGATCTTGATGATCCTTACATTCTCATTCACGAAAAGAAACTGTCTAATTTGCAA
TCCTTGCTTCCCGTTTTGGAAGCCGTTGTTCAGTCTGGCAAACCCCTTCTTATCATTGCT
GAAGATGTGGAAGGTGAAGCTTTGGCAACGCTCGTGGTCAACAAATTGCGCGGTGGTTTG
AAAATTGCTGCTGTA
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLGQAIVQEGVKAVAAGMNPMDLKRGIDAAVDEVVANLFKKAKKIQTSAEIAQVGTIS
ANGAAEIGKMIADAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNAEKM
VADLDDPYILIHEKKLSNLQSLLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGL
KIAAV