RECORD DETAILS

Add Record To Cart - Printer-friendly version - Close Window
Chaperonin ID: b14565
Chaperonin Group: I
Deposit Date: 2009-09-01
Type: fie
Type strain?: no
Genus: Acetobacter
Species: pasteurianus
Strain: IFO 3283-12
Lineage: root; cellular organisms; Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acetobacter
Original ID: -
CUTC ID: -
Nucleotide Genbank Accession: AP011170
Peptide Genbank Accession: BAI21184
Best FASTA Match: b14572 Acetobacter pasteurianus IFO 3283-01 (see fasta results)
Date of FASTA search: 2020-09-21
FASTA identity %: 100.000
Best BLASTP Match: b34708 Acetobacter oryzifermentans dm (see blastp results)
Date of BLASTP search: 2020-09-21
BLASTP identity %: 100.000
Source: Genbank
Notes: Part of a study of multiple isolates of the same strain; examination of genomic instability.
Full Nucleotide Sequence:
BLAST this sequence:
cpnDB |
ATGGCTGCCAAAGACGTAAAGTTTGGTGCAGACGCACGCCAGCGTATGCTGCGCGGTGTG
GATATTCTGGCTGACGCTGTAAAAGTAACGCTGGGCCCCAAAGGCCGTAACGTGGTGCTG
GACAAGAGCTTCGGTGCTCCCCGTATCACCAAGGACGGCGTTTCCGTTGCCAAGGAAATC
GAACTGGCTGACAAGTTCGAAAACATGGGCGCTCAGATGCTGCGTGAAGTAGCATCCAAA
ACCAACGACATTGCTGGTGACGGCACCACAACGGCTACGGTTCTGGCTCAGGCTATCGTG
CGTGAAGGCCACAAGGCTGTTGCCGCTGGCATGAACCCGATGGATCTGAAGCGCGGGATC
GACAAGGCTGTTGCCGTTGTGATCGAAGAGCTGAAGAAAAACGCCAAGAAAGTAACCACC
CCGGCGGAAACCGCTCAGGTTGGTACGATTTCTGCAAACGGTGAATCTGAAATCGGTCAG
ATGATCTCCGAAGCCATGCAGAAAGTTGGCTCCGAAGGCGTGATCACGGTTGAAGAAGCC
AAGCACTTCCAGACAGAACTGGATGTTGTTGAAGGCATGCAGTTTGACCGCGGCTACATC
TCTCCGTACTTCGTGACGAACCCGGAAAAGATGACAGCGGATCTGGAAAACCCCTACATC
CTGATCCATGAAAAGAAGCTGTCTTCCCTGCAGCCCATGCTGCCGCTGCTGGAATCTGTT
GTTCAGTCCGGCCGTCCGCTGCTGATCATTGCAGAAGACGTTGACGGTGAAGCTCTGGCA
ACTCTGGTTGTCAACAAGCTGCGCGGTGGCCTGAAAATTGCTGCTGTTAAGGCTCCGGGC
TTTGGTGATCGCCGCAAGGCTATGCTGGAAGACATTGCTATCCTTACGGGTGGTCAGGTC
ATCAGCGAAGATCTGGGCATCAAGCTAGAAACCGTTACCCTGAACATGCTTGGCACCGCC
AAGAAAGTACACATCGACAAAGAAAACACCACCATTGTTGATGGTGCTGGCAAAGCCGAT
GACATCAAGGGTCGCGTTAAACAGATTCGTGCACAGATCGAAGAAACCTCTTCCGACTAC
GACCGCGAAAAGCTGCAGGAACGTCTGGCCAAACTGGCTGGCGGTGTTGCCGTGATCCGC
GTTGGTGGTTCCACCGAAGTGGAAGTGAAAGAACGGAAAGACCGCGTTGACGATGCCCTG
CATGCAACCCGCGCTGCTGTGGAAGAAGGCATTGTTCCGGGTGGTGGCACGGCTCTGGCC
CGCGCTACGCTGAAGCTGGAAGGCCTGCACTACCACAACGATGACCAGCGCGTTGGTGGG
GACATCATCCGCCGCGCTCTGCAGGCTCCTCTGCGCCAGATCGCTCACAACGCTGGTGAA
GACGGCGCTGTGATCGCAAACAAGGTGCTGGAAAACAGCGACTACAACTTCGGGTTCGAC
GCTCAGGCTGGCGAATACAAGAACCTGGTTGAAGCCGGTATTATCGACCCGGCCAAGGTT
GTCCGCACGGCTCTGCAGGATGCAGCATCTGTTGCTGGTCTGCTGATCACCACGGAAGCC
ATGGTTGCTGAACGCCCGGAAAAGAAAGCCGCTCCGGCTGGCGGCCCTGACATGGGTGGT
ATGGGTGGTATGGACTTCTAA
Full Peptide Sequence:
BLAST this sequence:
cpnDB |
MAAKDVKFGADARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEI
ELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGI
DKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEA
KHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENPYILIHEKKLSSLQPMLPLLESV
VQSGRPLLIIAEDVDGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLEDIAILTGGQV
ISEDLGIKLETVTLNMLGTAKKVHIDKENTTIVDGAGKADDIKGRVKQIRAQIEETSSDY
DREKLQERLAKLAGGVAVIRVGGSTEVEVKERKDRVDDALHATRAAVEEGIVPGGGTALA
RATLKLEGLHYHNDDQRVGGDIIRRALQAPLRQIAHNAGEDGAVIANKVLENSDYNFGFD
AQAGEYKNLVEAGIIDPAKVVRTALQDAASVAGLLITTEAMVAERPEKKAAPAGGPDMGG
MGGMDF
Nucleotide UT Sequence:
BLAST this sequence:
cpnDB |
GCTACGGTTCTGGCTCAGGCTATCGTGCGTGAAGGCCACAAGGCTGTTGCCGCTGGCATG
AACCCGATGGATCTGAAGCGCGGGATCGACAAGGCTGTTGCCGTTGTGATCGAAGAGCTG
AAGAAAAACGCCAAGAAAGTAACCACCCCGGCGGAAACCGCTCAGGTTGGTACGATTTCT
GCAAACGGTGAATCTGAAATCGGTCAGATGATCTCCGAAGCCATGCAGAAAGTTGGCTCC
GAAGGCGTGATCACGGTTGAAGAAGCCAAGCACTTCCAGACAGAACTGGATGTTGTTGAA
GGCATGCAGTTTGACCGCGGCTACATCTCTCCGTACTTCGTGACGAACCCGGAAAAGATG
ACAGCGGATCTGGAAAACCCCTACATCCTGATCCATGAAAAGAAGCTGTCTTCCCTGCAG
CCCATGCTGCCGCTGCTGGAATCTGTTGTTCAGTCCGGCCGTCCGCTGCTGATCATTGCA
GAAGACGTTGACGGTGAAGCTCTGGCAACTCTGGTTGTCAACAAGCTGCGCGGTGGCCTG
AAAATTGCTGCTGTT
Peptide UT Sequence:
BLAST this sequence:
cpnDB |
ATVLAQAIVREGHKAVAAGMNPMDLKRGIDKAVAVVIEELKKNAKKVTTPAETAQVGTIS
ANGESEIGQMISEAMQKVGSEGVITVEEAKHFQTELDVVEGMQFDRGYISPYFVTNPEKM
TADLENPYILIHEKKLSSLQPMLPLLESVVQSGRPLLIIAEDVDGEALATLVVNKLRGGL
KIAAV