/aliases/cpndb/blastp_results/b12498.blastp BLAST Search Results
BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= b12498
         (185 letters)

Database: reference_a_ut 
           18,127 sequences; 3,349,483 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

b11999  YP_002377090 Cyanothece sp. PCC 7424                      361   e-130
b29641  WP_085432686 Cyanobacterium sp. SU2                       343   e-123
b13317  BAH22173 Spirulina subsalsa M-223                         343   e-123
b27637  WP_017306382 Spirulina  subsalsa  PCC 9445                341   e-122
b11951  YP_002373009 Cyanothece sp. PCC 8801                      338   e-121
b34672  WP_002744527 Microcystis  panniformis  FACHB-1757         337   e-120
b33604  REJ45839 Microcystis  flos-aquae DF17                     337   e-120
b33603  REJ56133 Microcystis  wesenbergii TW10                    337   e-120
b22917  ELS47550 Microcystis aeruginosa DIANCHI905                337   e-120
b22606  ELP55267 Microcystis aeruginosa TAIHU98                   337   e-120
b20906  CCI22514 Microcystis aeruginosa PCC 9809                  337   e-120
b20905  CCI27559 Microcystis aeruginosa PCC 9809                  337   e-120
b10742  BAG04430 Microcystis aeruginosa NIES-843                  337   e-120
b10648  CAO88453 Microcystis aeruginosa PCC 7806                  337   e-120
b33173  PZV27236 Snowella  sp. ULC335bin1                         336   e-120
b13338  BAH22152 Stanieria cyanosphaera PCC 7437                  335   e-120
b31254  PHV64238 Cyanobacterium  aponinum  IPPAS B-1201           335   e-120
b31225  WP_015218965 Cyanobacterium  aponinum  IPPAS B-1201       335   e-120
b31165  WP_096382985 Stanieria sp. NIES-3757                      335   e-120
b13335  BAH22155 Geitlerinema sp. PCC 7105                        335   e-120
>b11999 YP_002377090 Cyanothece sp. PCC 7424
          Length = 185

 Score =  361 bits (927), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 181/185 (97%), Positives = 183/185 (98%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHAMVKEGLRNVAAGANPISIKRGIDKA EYLV KIAEHAKPVEDSKAISQVGAIS
Sbjct: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKAIEYLVAKIAEHAKPVEDSKAISQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGNDEEVG+MIA+AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDEEVGNMIAEAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b29641 WP_085432686 Cyanobacterium sp. SU2
          Length = 185

 Score =  343 bits (881), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 179/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPI++KRG+DKATE+LVGKIAEHAKP+EDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPIALKRGVDKATEFLVGKIAEHAKPIEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGNDEEVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDEEVGQMIANAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           E VFDDP+ILLTDKKI LVQDLVPVLEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 EAVFDDPSILLTDKKITLVQDLVPVLEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
            VAAV
Sbjct: 181 TVAAV 185
>b13317 BAH22173 Spirulina subsalsa M-223
          Length = 185

 Score =  343 bits (879), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHAMVKEGLRNVAAGANPI+IKRG+DKA EYLVGKIAEHAKPVEDSKAI+QVG+IS
Sbjct: 1   ATVLAHAMVKEGLRNVAAGANPIAIKRGVDKAVEYLVGKIAEHAKPVEDSKAIAQVGSIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGNDEEVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDEEVGQMIANAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           E V DDP IL+TDKKI LVQDLVPVLEQVAR+G+PL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 EAVLDDPYILITDKKITLVQDLVPVLEQVARSGRPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b27637 WP_017306382 Spirulina  subsalsa  PCC 9445
          Length = 185

 Score =  341 bits (874), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 168/185 (90%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHAMVKEGLRNVAAGANPI+IKRG+DKA EYLVGKIAEHAKPVEDSKAI+QVG+IS
Sbjct: 1   ATVLAHAMVKEGLRNVAAGANPIAIKRGVDKAVEYLVGKIAEHAKPVEDSKAIAQVGSIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGNDEEVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDEEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           E V D+P IL+TDKKI LVQDLVPVLEQVAR+G+PL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 EAVLDEPYILITDKKITLVQDLVPVLEQVARSGRPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b11951 YP_002373009 Cyanothece sp. PCC 8801
          Length = 185

 Score =  338 bits (868), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 177/185 (95%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+KRGIDKATE+LV KIA +AKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKRGIDKATEFLVEKIAAYAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIANAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECV DDPAILLTDKKI LVQDLVPVLEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVLDDPAILLTDKKITLVQDLVPVLEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
            VAAV
Sbjct: 181 TVAAV 185
>b34672 WP_002744527 Microcystis  panniformis  FACHB-1757
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b33604 REJ45839 Microcystis  flos-aquae DF17 
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b33603 REJ56133 Microcystis  wesenbergii TW10 
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b22917 ELS47550 Microcystis aeruginosa DIANCHI905
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b22606 ELP55267 Microcystis aeruginosa TAIHU98
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b20906 CCI22514 Microcystis aeruginosa PCC 9809
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b20905 CCI27559 Microcystis aeruginosa PCC 9809
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b10742 BAG04430 Microcystis aeruginosa NIES-843
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b10648 CAO88453 Microcystis aeruginosa PCC 7806
          Length = 185

 Score =  337 bits (863), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/185 (88%), Positives = 178/185 (96%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPIS+K+GIDKA ++LV +IA+HAKPVEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPISLKKGIDKAADFLVSQIAKHAKPVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDDEVGQMIASAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECVF+DPAIL+TDKKI LVQDLVP+LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVFEDPAILITDKKIGLVQDLVPILEQVARQGKPLVIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NV AV
Sbjct: 181 NVTAV 185
>b33173 PZV27236 Snowella  sp. ULC335bin1 
          Length = 185

 Score =  336 bits (862), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 168/185 (90%), Positives = 177/185 (95%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPI+IKRGIDKATE+LV +IAEHAKPVEDSKAI+QVG+IS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPIAIKRGIDKATEFLVERIAEHAKPVEDSKAIAQVGSIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGNDEEVG MIA AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTD ERM
Sbjct: 61  AGNDEEVGQMIANAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDPERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           E V +DPAIL+TDKKI LVQDLVPVLEQVAR GKPLLI+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 EAVLEDPAILITDKKINLVQDLVPVLEQVARQGKPLLIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b13338 BAH22152 Stanieria cyanosphaera PCC 7437
          Length = 185

 Score =  335 bits (860), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/185 (89%), Positives = 176/185 (95%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPI++KRGIDKATEYLV KIA+HAK +EDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPIALKRGIDKATEYLVDKIAQHAKQIEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND+EVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGY SPYFVTDTERM
Sbjct: 61  AGNDDEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYTSPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           E V DDP IL+TDKKI LVQDLVP LEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 EAVLDDPFILITDKKITLVQDLVPSLEQVARQGKPLMIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b31254 PHV64238 Cyanobacterium  aponinum  IPPAS B-1201
          Length = 185

 Score =  335 bits (860), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/185 (89%), Positives = 176/185 (95%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPI++KRGIDKATE+LV KIAEHA+ VEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPIALKRGIDKATEHLVAKIAEHARKVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND EVG MIAQAMDKVG+EGVISLEEGKSM TELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDTEVGEMIAQAMDKVGQEGVISLEEGKSMETELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECV DDP IL+TDKKI LVQDLVPVLEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVLDDPYILVTDKKITLVQDLVPVLEQVARQGKPLMIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b31225 WP_015218965 Cyanobacterium  aponinum  IPPAS B-1201
          Length = 185

 Score =  335 bits (860), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/185 (89%), Positives = 176/185 (95%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPI++KRGIDKATE+LV KIAEHA+ VEDSKAI+QVGAIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPIALKRGIDKATEHLVAKIAEHARKVEDSKAIAQVGAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGND EVG MIAQAMDKVG+EGVISLEEGKSM TELEITEGMRFDKGYISPYFVTDTERM
Sbjct: 61  AGNDTEVGEMIAQAMDKVGQEGVISLEEGKSMETELEITEGMRFDKGYISPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           ECV DDP IL+TDKKI LVQDLVPVLEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 ECVLDDPYILVTDKKITLVQDLVPVLEQVARQGKPLMIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b31165 WP_096382985 Stanieria sp. NIES-3757
          Length = 185

 Score =  335 bits (859), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/185 (89%), Positives = 176/185 (95%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHA+VKEGLRNVAAGANPI++KRGIDKATEYLV KIA+HAK +EDSKAI+QV AIS
Sbjct: 1   ATVLAHAIVKEGLRNVAAGANPIALKRGIDKATEYLVDKIAQHAKQIEDSKAIAQVAAIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGNDEEVGSMIA+AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGY SPYFVTDTERM
Sbjct: 61  AGNDEEVGSMIAEAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYTSPYFVTDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           E V DDP IL+TDKKI LVQDLVPVLEQVAR GKPL+I+AEDIEKEALATLVVNRLRGVL
Sbjct: 121 EAVLDDPFILITDKKITLVQDLVPVLEQVARQGKPLMIIAEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
>b13335 BAH22155 Geitlerinema sp. PCC 7105
          Length = 185

 Score =  335 bits (858), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (94%)

Query: 1   ATVLAHAMVKEGLRNVAAGANPISIKRGIDKATEYLVGKIAEHAKPVEDSKAISQVGAIS 60
           ATVLAHAMVKEGLRNVAAGANPI+IKRGID+AT YLV KIAEHA+PVEDS AISQVG IS
Sbjct: 1   ATVLAHAMVKEGLRNVAAGANPIAIKRGIDRATAYLVDKIAEHARPVEDSTAISQVGTIS 60

Query: 61  AGNDEEVGSMIAQAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFVTDTERM 120
           AGNDEEVG MIA+AMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYF TDTERM
Sbjct: 61  AGNDEEVGRMIAEAMDKVGKEGVISLEEGKSMTTELEITEGMRFDKGYISPYFATDTERM 120

Query: 121 ECVFDDPAILLTDKKIALVQDLVPVLEQVARAGKPLLILAEDIEKEALATLVVNRLRGVL 180
           E + D+P ILLTDKKI+LVQDLVPV EQVAR+GKPLLI++EDIEKEALATLVVNRLRGVL
Sbjct: 121 EAILDEPFILLTDKKISLVQDLVPVFEQVARSGKPLLIISEDIEKEALATLVVNRLRGVL 180

Query: 181 NVAAV 185
           NVAAV
Sbjct: 181 NVAAV 185
  Database: reference_a_ut
    Posted date:  Sep 21, 2020  1:00 AM
  Number of letters in database: 3,349,483
  Number of sequences in database:  18,127
  
Lambda     K      H
   0.315    0.133    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 18127
Number of Hits to DB: 2,737,708
Number of extensions: 102427
Number of successful extensions: 27603
Number of sequences better than 10.0: 18110
Number of HSP's gapped: 18119
Number of HSP's successfully gapped: 18114
Length of query: 185
Length of database: 3,349,483
Length adjustment: 82
Effective length of query: 103
Effective length of database: 1,863,069
Effective search space: 191896107
Effective search space used: 191896107
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)